BLASTX nr result
ID: Papaver29_contig00043852
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043852 (550 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010272871.1| PREDICTED: pre-rRNA-processing protein TSR2-... 48 2e-06 >ref|XP_010272871.1| PREDICTED: pre-rRNA-processing protein TSR2-like [Nelumbo nucifera] gi|720053884|ref|XP_010272872.1| PREDICTED: pre-rRNA-processing protein TSR2-like [Nelumbo nucifera] Length = 204 Score = 48.1 bits (113), Expect(2) = 2e-06 Identities = 20/31 (64%), Positives = 27/31 (87%) Frame = -3 Query: 542 LMIMHEECLQGKYEEIQKLRTSSNGSKAVSK 450 LMIMHE+CLQG YE I+KLR S++G +A+S+ Sbjct: 103 LMIMHEDCLQGNYESIEKLRKSNSGKEAISQ 133 Score = 30.0 bits (66), Expect(2) = 2e-06 Identities = 11/27 (40%), Positives = 19/27 (70%) Frame = -2 Query: 375 VDDPKESNTIEVEEGWCVVAGKKSKAR 295 VD+ + T+EVE+GW VV +++K + Sbjct: 171 VDEKQIRETVEVEDGWSVVGPRRNKGK 197