BLASTX nr result
ID: Papaver29_contig00043688
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043688 (1222 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010054103.1| PREDICTED: 4-coumarate--CoA ligase-like 6 is... 43 2e-06 >ref|XP_010054103.1| PREDICTED: 4-coumarate--CoA ligase-like 6 isoform X1 [Eucalyptus grandis] Length = 558 Score = 42.7 bits (99), Expect(2) = 2e-06 Identities = 29/77 (37%), Positives = 36/77 (46%) Frame = -1 Query: 661 ATNSIVDEEGWLHAGDIVMLDRLKDTIQGISGRSPELNRYRSCIICKCSFTNRVGDFYFS 482 AT ++DE+GWLH GDIV D +D I R E+ +Y Sbjct: 423 ATRLMIDEDGWLHTGDIVHFD--QDGFLHILDRVKEIIKY-------------------- 460 Query: 481 L*KTMQIAPADLEPVLV 431 K QIAPADLE VL+ Sbjct: 461 --KGFQIAPADLEGVLI 475 Score = 37.7 bits (86), Expect(2) = 2e-06 Identities = 17/29 (58%), Positives = 19/29 (65%) Frame = -2 Query: 774 TSAGLLAPIMQPKVVHWDTAPCFPPGKSG 688 +S GLLAP MQ KV+ W T PPG SG Sbjct: 370 SSIGLLAPNMQAKVLDWKTGSFLPPGSSG 398