BLASTX nr result
ID: Papaver29_contig00043501
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043501 (788 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putati... 60 1e-06 ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putati... 60 1e-06 ref|XP_007039138.1| General transcription factor 3C polypeptide ... 60 1e-06 >ref|XP_007039140.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] gi|508776385|gb|EOY23641.1| Transcription factor IIIC, subunit 5, putative isoform 3 [Theobroma cacao] Length = 579 Score = 60.5 bits (145), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 671 KREDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 775 K EDLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 362 KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 396 >ref|XP_007039139.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] gi|508776384|gb|EOY23640.1| Transcription factor IIIC, subunit 5, putative isoform 2 [Theobroma cacao] Length = 582 Score = 60.5 bits (145), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 671 KREDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 775 K EDLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 362 KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 396 >ref|XP_007039138.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] gi|508776383|gb|EOY23639.1| General transcription factor 3C polypeptide 5, putative isoform 1 [Theobroma cacao] Length = 630 Score = 60.5 bits (145), Expect = 1e-06 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = +2 Query: 671 KREDLCPFRVFPWKCQTALQLFKLDDGYFQQEIKK 775 K EDLC FRVFP+KCQT LQLF+LDD Y QQEI+K Sbjct: 370 KWEDLCSFRVFPYKCQTFLQLFELDDDYIQQEIRK 404