BLASTX nr result
ID: Papaver29_contig00043454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043454 (567 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269268.1| PREDICTED: probable mitochondrial adenine nu... 108 2e-21 ref|XP_010027855.1| PREDICTED: probable mitochondrial adenine nu... 108 2e-21 ref|XP_014508805.1| PREDICTED: probable mitochondrial adenine nu... 107 4e-21 gb|KOM30717.1| hypothetical protein LR48_Vigan01g027100 [Vigna a... 107 4e-21 ref|XP_011022795.1| PREDICTED: probable mitochondrial adenine nu... 107 4e-21 gb|KHN29056.1| Calcium-binding mitochondrial carrier protein SCa... 107 4e-21 ref|XP_003532822.1| PREDICTED: probable mitochondrial adenine nu... 107 4e-21 ref|XP_002284152.3| PREDICTED: probable mitochondrial adenine nu... 107 5e-21 ref|XP_006380415.1| hypothetical protein POPTR_0007s05420g [Popu... 107 5e-21 ref|XP_004288199.1| PREDICTED: probable mitochondrial adenine nu... 107 5e-21 emb|CBI19159.3| unnamed protein product [Vitis vinifera] 107 5e-21 ref|XP_010087596.1| Calcium-binding mitochondrial carrier protei... 106 7e-21 ref|XP_010267892.1| PREDICTED: probable mitochondrial adenine nu... 106 7e-21 ref|XP_007159659.1| hypothetical protein PHAVU_002G256400g [Phas... 106 7e-21 ref|XP_013446807.1| substrate carrier family protein [Medicago t... 105 1e-20 ref|XP_008219424.1| PREDICTED: probable mitochondrial adenine nu... 105 2e-20 ref|NP_001132533.1| uncharacterized LOC100193996 [Zea mays] gi|6... 105 2e-20 ref|XP_004504076.1| PREDICTED: probable mitochondrial adenine nu... 105 2e-20 ref|XP_008658666.1| PREDICTED: uncharacterized protein LOC100193... 105 2e-20 ref|XP_010109961.1| Mitochondrial substrate carrier family prote... 105 2e-20 >ref|XP_010269268.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Nelumbo nucifera] Length = 442 Score = 108 bits (270), Expect = 2e-21 Identities = 54/62 (87%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+AT+LS LATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 381 RQLQMQVQATKLSALATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKIVLK 440 Query: 387 VE 382 VE Sbjct: 441 VE 442 >ref|XP_010027855.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Eucalyptus grandis] gi|629088238|gb|KCW54491.1| hypothetical protein EUGRSUZ_I00436 [Eucalyptus grandis] Length = 420 Score = 108 bits (270), Expect = 2e-21 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQ+++TRLSPLATC KIVE+GGVPALYAGLIPSLLQVLPSA ISY VYEFMKI+ K Sbjct: 357 RQLQMQLRSTRLSPLATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYLVYEFMKIVLK 416 Query: 387 VE 382 VE Sbjct: 417 VE 418 >ref|XP_014508805.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Vigna radiata var. radiata] Length = 419 Score = 107 bits (267), Expect = 4e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+ATRL+ LATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMK++ K Sbjct: 356 RQLQLQVRATRLNALATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKVVLK 415 Query: 387 VE 382 VE Sbjct: 416 VE 417 >gb|KOM30717.1| hypothetical protein LR48_Vigan01g027100 [Vigna angularis] Length = 437 Score = 107 bits (267), Expect = 4e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+ATRL+ LATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMK++ K Sbjct: 374 RQLQLQVRATRLNALATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKVVLK 433 Query: 387 VE 382 VE Sbjct: 434 VE 435 >ref|XP_011022795.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Populus euphratica] Length = 434 Score = 107 bits (267), Expect = 4e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+AT++S LATC KIVE+GG+PALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 371 RQLQMQVRATKMSALATCIKIVEQGGIPALYAGLIPSLLQVLPSAAISYFVYEFMKIVLK 430 Query: 387 VE 382 VE Sbjct: 431 VE 432 >gb|KHN29056.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Glycine soja] Length = 299 Score = 107 bits (267), Expect = 4e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+ATRL+ LATC KIVE+GGVPALY GLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 236 RQLQMQVRATRLNALATCVKIVEQGGVPALYVGLIPSLLQVLPSAAISYFVYEFMKIVLK 295 Query: 387 VE 382 VE Sbjct: 296 VE 297 >ref|XP_003532822.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3-like [Glycine max] gi|947094593|gb|KRH43178.1| hypothetical protein GLYMA_08G135300 [Glycine max] Length = 415 Score = 107 bits (267), Expect = 4e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+ATRL+ LATC KIVE+GGVPALY GLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 352 RQLQMQVRATRLNALATCVKIVEQGGVPALYVGLIPSLLQVLPSAAISYFVYEFMKIVLK 411 Query: 387 VE 382 VE Sbjct: 412 VE 413 >ref|XP_002284152.3| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Vitis vinifera] Length = 443 Score = 107 bits (266), Expect = 5e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+AT+LS LATC KIVE GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 382 RQLQLQVQATKLSALATCVKIVEHGGVPALYAGLIPSLLQVLPSASISYFVYEFMKIVLK 441 Query: 387 VE 382 VE Sbjct: 442 VE 443 >ref|XP_006380415.1| hypothetical protein POPTR_0007s05420g [Populus trichocarpa] gi|550334181|gb|ERP58212.1| hypothetical protein POPTR_0007s05420g [Populus trichocarpa] Length = 423 Score = 107 bits (266), Expect = 5e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+AT++S LATC KIVE+GG+PALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 360 RQLQMQVQATKMSALATCIKIVEQGGIPALYAGLIPSLLQVLPSASISYFVYEFMKIVLK 419 Query: 387 VE 382 VE Sbjct: 420 VE 421 >ref|XP_004288199.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Fragaria vesca subsp. vesca] Length = 413 Score = 107 bits (266), Expect = 5e-21 Identities = 53/62 (85%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+A +LS +ATCAKIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 350 RQLQMQVRANKLSAVATCAKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKILLK 409 Query: 387 VE 382 VE Sbjct: 410 VE 411 >emb|CBI19159.3| unnamed protein product [Vitis vinifera] Length = 297 Score = 107 bits (266), Expect = 5e-21 Identities = 53/62 (85%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+AT+LS LATC KIVE GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 236 RQLQLQVQATKLSALATCVKIVEHGGVPALYAGLIPSLLQVLPSASISYFVYEFMKIVLK 295 Query: 387 VE 382 VE Sbjct: 296 VE 297 >ref|XP_010087596.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus notabilis] gi|587838762|gb|EXB29451.1| Calcium-binding mitochondrial carrier protein SCaMC-1 [Morus notabilis] Length = 442 Score = 106 bits (265), Expect = 7e-21 Identities = 51/62 (82%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+ATRLS L+TC KIVE+GG+PALYAGL+PSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 379 RQLQLQVRATRLSALSTCMKIVEQGGIPALYAGLVPSLLQVLPSAAISYFVYEFMKIVLK 438 Query: 387 VE 382 VE Sbjct: 439 VE 440 >ref|XP_010267892.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Nelumbo nucifera] Length = 470 Score = 106 bits (265), Expect = 7e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+AT+L+ +ATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 409 RQLQMQVQATKLNAMATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKIVLK 468 Query: 387 VE 382 VE Sbjct: 469 VE 470 >ref|XP_007159659.1| hypothetical protein PHAVU_002G256400g [Phaseolus vulgaris] gi|561033074|gb|ESW31653.1| hypothetical protein PHAVU_002G256400g [Phaseolus vulgaris] Length = 414 Score = 106 bits (265), Expect = 7e-21 Identities = 52/62 (83%), Positives = 58/62 (93%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQV+ATRL+ +ATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ + Sbjct: 351 RQLQMQVRATRLNAMATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKIVLE 410 Query: 387 VE 382 VE Sbjct: 411 VE 412 >ref|XP_013446807.1| substrate carrier family protein [Medicago truncatula] gi|388493674|gb|AFK34903.1| unknown [Medicago truncatula] gi|657375512|gb|KEH20834.1| substrate carrier family protein [Medicago truncatula] Length = 402 Score = 105 bits (263), Expect = 1e-20 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+ATRL+ LATC KIVE+GGVPALYAGL PSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 339 RQLQLQVRATRLNALATCVKIVEQGGVPALYAGLTPSLLQVLPSAAISYFVYEFMKIVLK 398 Query: 387 VE 382 VE Sbjct: 399 VE 400 >ref|XP_008219424.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Prunus mume] Length = 461 Score = 105 bits (262), Expect = 2e-20 Identities = 51/62 (82%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV+AT++S LATC KIVE GGVPALYAGL+PSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 400 RQLQLQVQATKMSALATCMKIVEHGGVPALYAGLVPSLLQVLPSAAISYFVYEFMKIVLK 459 Query: 387 VE 382 VE Sbjct: 460 VE 461 >ref|NP_001132533.1| uncharacterized LOC100193996 [Zea mays] gi|670362367|ref|XP_008651939.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Zea mays] gi|194694656|gb|ACF81412.1| unknown [Zea mays] gi|414865264|tpg|DAA43821.1| TPA: hypothetical protein ZEAMMB73_399658 [Zea mays] gi|414865266|tpg|DAA43823.1| TPA: hypothetical protein ZEAMMB73_327607 [Zea mays] Length = 254 Score = 105 bits (262), Expect = 2e-20 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQVKATR++ LATC KIV++GGVPALYAGLIPSLLQVLPSA ISYFVYE MKI+ K Sbjct: 193 RQLQMQVKATRMNALATCLKIVDQGGVPALYAGLIPSLLQVLPSASISYFVYELMKIVLK 252 Query: 387 VE 382 VE Sbjct: 253 VE 254 >ref|XP_004504076.1| PREDICTED: probable mitochondrial adenine nucleotide transporter BTL3 [Cicer arietinum] Length = 415 Score = 105 bits (262), Expect = 2e-20 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQ+QV ATRL+ +ATC KIVE+GGVPALYAGLIPSLLQVLPSA ISYFVYEFMKI+ K Sbjct: 352 RQLQLQVPATRLNAVATCVKIVEQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKIVLK 411 Query: 387 VE 382 VE Sbjct: 412 VE 413 >ref|XP_008658666.1| PREDICTED: uncharacterized protein LOC100193996 isoform X1 [Zea mays] gi|414865267|tpg|DAA43824.1| TPA: hypothetical protein ZEAMMB73_327607 [Zea mays] Length = 425 Score = 105 bits (262), Expect = 2e-20 Identities = 52/62 (83%), Positives = 57/62 (91%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 RQLQMQVKATR++ LATC KIV++GGVPALYAGLIPSLLQVLPSA ISYFVYE MKI+ K Sbjct: 364 RQLQMQVKATRMNALATCLKIVDQGGVPALYAGLIPSLLQVLPSASISYFVYELMKIVLK 423 Query: 387 VE 382 VE Sbjct: 424 VE 425 >ref|XP_010109961.1| Mitochondrial substrate carrier family protein B [Morus notabilis] gi|587938200|gb|EXC24957.1| Mitochondrial substrate carrier family protein B [Morus notabilis] Length = 416 Score = 105 bits (261), Expect = 2e-20 Identities = 51/62 (82%), Positives = 59/62 (95%) Frame = -1 Query: 567 RQLQMQVKATRLSPLATCAKIVERGGVPALYAGLIPSLLQVLPSAGISYFVYEFMKIIFK 388 R+LQ+QV+ATRLS LATCA+IV++GGVPALYAGLIPSLLQVLPSA ISYFVYEFMK++ K Sbjct: 355 RKLQLQVQATRLSALATCAEIVKQGGVPALYAGLIPSLLQVLPSAAISYFVYEFMKVVLK 414 Query: 387 VE 382 VE Sbjct: 415 VE 416