BLASTX nr result
ID: Papaver29_contig00043150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00043150 (414 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KMZ56657.1| putative Mitochondrial carrier protein [Zostera m... 69 1e-09 ref|XP_010921017.1| PREDICTED: mitoferrin [Elaeis guineensis] 69 2e-09 ref|XP_008808034.1| PREDICTED: LOW QUALITY PROTEIN: mitoferrin-l... 68 2e-09 ref|XP_011046815.1| PREDICTED: mitoferrin-like [Populus euphratica] 67 4e-09 ref|XP_002323023.1| hypothetical protein POPTR_0016s13300g [Popu... 67 4e-09 ref|XP_009421401.1| PREDICTED: mitoferrin-like isoform X1 [Musa ... 67 5e-09 ref|XP_011624472.1| PREDICTED: mitoferrin [Amborella trichopoda] 67 7e-09 gb|ERN09024.1| hypothetical protein AMTR_s00153p00093350 [Ambore... 67 7e-09 ref|XP_004294768.1| PREDICTED: mitoferrin [Fragaria vesca subsp.... 67 7e-09 ref|XP_014489788.1| PREDICTED: mitoferrin-like [Vigna radiata va... 66 9e-09 gb|KOM47316.1| hypothetical protein LR48_Vigan07g102000 [Vigna a... 66 9e-09 gb|KNA22007.1| hypothetical protein SOVF_038000 [Spinacia oleracea] 66 9e-09 gb|KNA08037.1| hypothetical protein SOVF_166290 [Spinacia oleracea] 66 9e-09 ref|XP_007142146.1| hypothetical protein PHAVU_008G256400g [Phas... 66 9e-09 ref|XP_004984881.1| PREDICTED: mitoferrin [Setaria italica] gi|9... 66 9e-09 ref|XP_004490660.1| PREDICTED: mitoferrin-like [Cicer arietinum] 66 9e-09 ref|XP_003544903.1| PREDICTED: mitoferrin-like [Glycine max] gi|... 66 9e-09 gb|KMZ56658.1| putative Mitochondrial carrier protein [Zostera m... 66 1e-08 ref|XP_012444809.1| PREDICTED: mitoferrin-like [Gossypium raimon... 65 2e-08 ref|XP_012471687.1| PREDICTED: mitoferrin-like [Gossypium raimon... 65 2e-08 >gb|KMZ56657.1| putative Mitochondrial carrier protein [Zostera marina] Length = 321 Score = 68.9 bits (167), Expect = 1e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGWKPR+LFHAPAAAICWSTYEA K+FF N NK Sbjct: 283 MRGWKPRMLFHAPAAAICWSTYEAAKSFFQNSNDNK 318 >ref|XP_010921017.1| PREDICTED: mitoferrin [Elaeis guineensis] Length = 321 Score = 68.6 bits (166), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGWKPR+LFHAPAAAICWSTYEA K+FF G N + Sbjct: 283 MRGWKPRMLFHAPAAAICWSTYEASKSFFQGFNERR 318 >ref|XP_008808034.1| PREDICTED: LOW QUALITY PROTEIN: mitoferrin-like [Phoenix dactylifera] Length = 321 Score = 68.2 bits (165), Expect = 2e-09 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 +RGWKPR+LFHAPAAAICWSTYEA K+FF G N K Sbjct: 283 LRGWKPRMLFHAPAAAICWSTYEASKSFFQGFNDRK 318 >ref|XP_011046815.1| PREDICTED: mitoferrin-like [Populus euphratica] Length = 332 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNAN 310 MRGW PR+LFHAPAAAICWSTYEA K FFH +N N Sbjct: 295 MRGWIPRMLFHAPAAAICWSTYEASKDFFHRLNGN 329 >ref|XP_002323023.1| hypothetical protein POPTR_0016s13300g [Populus trichocarpa] gi|222867653|gb|EEF04784.1| hypothetical protein POPTR_0016s13300g [Populus trichocarpa] Length = 329 Score = 67.4 bits (163), Expect = 4e-09 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNAN 310 MRGW PR+LFHAPAAAICWSTYEA K FFH +N N Sbjct: 292 MRGWIPRMLFHAPAAAICWSTYEASKDFFHRLNGN 326 >ref|XP_009421401.1| PREDICTED: mitoferrin-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 317 Score = 67.0 bits (162), Expect = 5e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGWKPR+LFHAPAAAICWSTYEA K+FF MN K Sbjct: 282 MRGWKPRMLFHAPAAAICWSTYEAMKSFFEQMNDQK 317 >ref|XP_011624472.1| PREDICTED: mitoferrin [Amborella trichopoda] Length = 323 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 +RGW+PR+LFHAPAAAICWSTYEA K FFH +N K Sbjct: 284 IRGWRPRMLFHAPAAAICWSTYEACKAFFHQLNTTK 319 >gb|ERN09024.1| hypothetical protein AMTR_s00153p00093350 [Amborella trichopoda] Length = 219 Score = 66.6 bits (161), Expect = 7e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 +RGW+PR+LFHAPAAAICWSTYEA K FFH +N K Sbjct: 180 IRGWRPRMLFHAPAAAICWSTYEACKAFFHQLNTTK 215 >ref|XP_004294768.1| PREDICTED: mitoferrin [Fragaria vesca subsp. vesca] Length = 332 Score = 66.6 bits (161), Expect = 7e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK*ASN 295 +RGW PR+LFHAPAAAICWSTYEA KTFF +N + +SN Sbjct: 288 VRGWAPRMLFHAPAAAICWSTYEASKTFFQELNGSSSSSN 327 >ref|XP_014489788.1| PREDICTED: mitoferrin-like [Vigna radiata var. radiata] Length = 324 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+LFHAPAAAICWSTYEAGK+FF N K Sbjct: 283 MRGWIPRMLFHAPAAAICWSTYEAGKSFFQDFNQQK 318 >gb|KOM47316.1| hypothetical protein LR48_Vigan07g102000 [Vigna angularis] Length = 358 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+LFHAPAAAICWSTYEAGK+FF N K Sbjct: 317 MRGWIPRMLFHAPAAAICWSTYEAGKSFFQDFNQQK 352 >gb|KNA22007.1| hypothetical protein SOVF_038000 [Spinacia oleracea] Length = 340 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK*ASN 295 MRGW PR++FHAPAAAICWSTYEA KTFF +N K +S+ Sbjct: 299 MRGWAPRMMFHAPAAAICWSTYEAAKTFFQELNDQKNSSS 338 >gb|KNA08037.1| hypothetical protein SOVF_166290 [Spinacia oleracea] Length = 341 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/40 (70%), Positives = 33/40 (82%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK*ASN 295 MRGW PR++FHAPAAAICWSTYEA KTFF +N K +S+ Sbjct: 300 MRGWAPRMMFHAPAAAICWSTYEAAKTFFQELNDQKNSSS 339 >ref|XP_007142146.1| hypothetical protein PHAVU_008G256400g [Phaseolus vulgaris] gi|561015279|gb|ESW14140.1| hypothetical protein PHAVU_008G256400g [Phaseolus vulgaris] Length = 324 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+LFHAPAAAICWSTYEAGK+FF N K Sbjct: 283 MRGWIPRMLFHAPAAAICWSTYEAGKSFFQDFNQQK 318 >ref|XP_004984881.1| PREDICTED: mitoferrin [Setaria italica] gi|944226881|gb|KQK91285.1| hypothetical protein SETIT_036537mg [Setaria italica] Length = 333 Score = 66.2 bits (160), Expect = 9e-09 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGWKPR+LFHAPAAAICWSTYEA K+FF +N + Sbjct: 296 MRGWKPRMLFHAPAAAICWSTYEASKSFFERLNEER 331 >ref|XP_004490660.1| PREDICTED: mitoferrin-like [Cicer arietinum] Length = 327 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+LFHAPAAAICWSTYEAGK+FF N K Sbjct: 286 MRGWVPRMLFHAPAAAICWSTYEAGKSFFQDYNEQK 321 >ref|XP_003544903.1| PREDICTED: mitoferrin-like [Glycine max] gi|947067965|gb|KRH17108.1| hypothetical protein GLYMA_14G198800 [Glycine max] Length = 324 Score = 66.2 bits (160), Expect = 9e-09 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+LFHAPAAAICWSTYEAGK+FF N K Sbjct: 283 MRGWIPRMLFHAPAAAICWSTYEAGKSFFQDFNQQK 318 >gb|KMZ56658.1| putative Mitochondrial carrier protein [Zostera marina] Length = 324 Score = 65.9 bits (159), Expect = 1e-08 Identities = 27/34 (79%), Positives = 31/34 (91%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNA 313 +RGWKPR+LFHAPAAAICWSTYEA K+FFH N+ Sbjct: 288 IRGWKPRMLFHAPAAAICWSTYEATKSFFHVQNS 321 >ref|XP_012444809.1| PREDICTED: mitoferrin-like [Gossypium raimondii] gi|763789146|gb|KJB56142.1| hypothetical protein B456_009G113200 [Gossypium raimondii] Length = 331 Score = 65.5 bits (158), Expect = 2e-08 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNA 313 MRGW PRILFHAPAAAICWSTYEA K+FF +NA Sbjct: 290 MRGWIPRILFHAPAAAICWSTYEAAKSFFQELNA 323 >ref|XP_012471687.1| PREDICTED: mitoferrin-like [Gossypium raimondii] gi|763753069|gb|KJB20457.1| hypothetical protein B456_003G149700 [Gossypium raimondii] Length = 331 Score = 65.5 bits (158), Expect = 2e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -1 Query: 414 MRGWKPRILFHAPAAAICWSTYEAGKTFFHGMNANK 307 MRGW PR+ FHAPAAAICWSTYEA KTFF +NA++ Sbjct: 290 MRGWIPRMFFHAPAAAICWSTYEAAKTFFQELNASR 325