BLASTX nr result
ID: Papaver29_contig00042152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00042152 (713 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006300703.1| hypothetical protein CARUB_v10019753mg [Caps... 58 7e-06 ref|XP_006301496.1| hypothetical protein CARUB_v10021922mg, part... 57 9e-06 >ref|XP_006300703.1| hypothetical protein CARUB_v10019753mg [Capsella rubella] gi|482569413|gb|EOA33601.1| hypothetical protein CARUB_v10019753mg [Capsella rubella] Length = 911 Score = 57.8 bits (138), Expect = 7e-06 Identities = 30/88 (34%), Positives = 47/88 (53%), Gaps = 5/88 (5%) Frame = -1 Query: 620 FPSLTTLIMDKLENLEEWFAPDNSFPCLEEVQIRWCGNLTSIPGLRLWTSSLRFLTIRG- 444 FP L L +D+ E LEEW + S PCL + + C L IPG + +SL+ L+I+ Sbjct: 820 FPQLRALKLDEQEELEEWIVEEGSMPCLHSLSLIGCKMLKEIPGGLKYITSLKELSIKSM 879 Query: 443 ----SEKLEKEPIEYYLHKFLPTVNYTR 372 EKL + +YY + +P + +T+ Sbjct: 880 KRSWKEKLSEGGEDYYKVQHIPRIQFTK 907 >ref|XP_006301496.1| hypothetical protein CARUB_v10021922mg, partial [Capsella rubella] gi|482570206|gb|EOA34394.1| hypothetical protein CARUB_v10021922mg, partial [Capsella rubella] Length = 882 Score = 57.4 bits (137), Expect = 9e-06 Identities = 35/92 (38%), Positives = 47/92 (51%), Gaps = 8/92 (8%) Frame = -1 Query: 620 FPSLTTLIMDKLENLEEWFAPDNSFPCLEEVQIRWCGNLTSIP---GLRLWTSSLRFLTI 450 FP L L +D + LEEW + S PCL + +R C NL +P GLR T SL+ TI Sbjct: 785 FPKLQILRLDSIPKLEEWTVEEGSMPCLHTLYLRRCSNLKKLPLPDGLRFIT-SLKEFTI 843 Query: 449 RGSE-----KLEKEPIEYYLHKFLPTVNYTRD 369 R E K+ K +YY + +P + Y D Sbjct: 844 RTKERELQNKVSKGGEDYYKIQHIPLIRYDWD 875