BLASTX nr result
ID: Papaver29_contig00042109
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00042109 (473 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007147409.1| hypothetical protein PHAVU_006G122000g [Phas... 84 5e-14 gb|KQL01770.1| hypothetical protein SETIT_015422mg, partial [Set... 79 1e-12 gb|KJB77370.1| hypothetical protein B456_012G134400 [Gossypium r... 76 9e-12 gb|KCW65068.1| hypothetical protein EUGRSUZ_G02580 [Eucalyptus g... 76 9e-12 gb|KMZ72544.1| putative Mitosis protein dim1 [Zostera marina] 76 1e-11 gb|KMZ72541.1| putative Mitosis protein dim1 [Zostera marina] 76 1e-11 ref|XP_010112537.1| Thioredoxin-like protein 4A [Morus notabilis... 76 1e-11 gb|KHG04565.1| Thioredoxin-like protein 4A [Gossypium arboreum] 76 1e-11 ref|XP_010423115.1| PREDICTED: thioredoxin-like protein YLS8 [Ca... 76 1e-11 ref|XP_009386081.1| PREDICTED: thioredoxin-like protein YLS8 [Mu... 76 1e-11 ref|XP_013625742.1| PREDICTED: thioredoxin-like protein YLS8 [Br... 76 1e-11 ref|XP_009122442.1| PREDICTED: thioredoxin-like protein YLS8 [Br... 76 1e-11 gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indi... 76 1e-11 gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK... 76 1e-11 ref|XP_006437597.1| hypothetical protein CICLE_v10033145mg [Citr... 76 1e-11 ref|XP_004293898.1| PREDICTED: thioredoxin-like protein YLS8 [Fr... 76 1e-11 ref|XP_004148041.1| PREDICTED: thioredoxin-like protein YLS8 [Cu... 76 1e-11 ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arab... 76 1e-11 ref|XP_003590204.1| mRNA splicing factor, thioredoxin-like U5 sn... 76 1e-11 ref|XP_002310072.1| hypothetical protein POPTR_0007s07660g [Popu... 76 1e-11 >ref|XP_007147409.1| hypothetical protein PHAVU_006G122000g [Phaseolus vulgaris] gi|561020632|gb|ESW19403.1| hypothetical protein PHAVU_006G122000g [Phaseolus vulgaris] Length = 180 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/41 (90%), Positives = 40/41 (97%) Frame = +1 Query: 349 RKEKGKKMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 +K+K KKMSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDW Sbjct: 32 KKKKKKKMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDW 72 >gb|KQL01770.1| hypothetical protein SETIT_015422mg, partial [Setaria italica] Length = 216 Score = 79.3 bits (194), Expect = 1e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = +1 Query: 364 KKMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 KKMSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDW Sbjct: 73 KKMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDW 108 >gb|KJB77370.1| hypothetical protein B456_012G134400 [Gossypium raimondii] Length = 207 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 364 KKMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 + MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 64 RTMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 99 >gb|KCW65068.1| hypothetical protein EUGRSUZ_G02580 [Eucalyptus grandis] Length = 317 Score = 76.3 bits (186), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +1 Query: 364 KKMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 + MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 174 RAMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 209 >gb|KMZ72544.1| putative Mitosis protein dim1 [Zostera marina] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >gb|KMZ72541.1| putative Mitosis protein dim1 [Zostera marina] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_010112537.1| Thioredoxin-like protein 4A [Morus notabilis] gi|587947709|gb|EXC33990.1| Thioredoxin-like protein 4A [Morus notabilis] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >gb|KHG04565.1| Thioredoxin-like protein 4A [Gossypium arboreum] Length = 145 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_010423115.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_009386081.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_013625742.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica oleracea var. oleracea] gi|923774351|ref|XP_013680479.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica napus] gi|674952637|emb|CDX81091.1| BnaC03g03450D [Brassica napus] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_009122442.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica rapa] gi|922561008|ref|XP_013608791.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica oleracea var. oleracea] gi|923844184|ref|XP_013701816.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Brassica napus] gi|923844187|ref|XP_013701817.1| PREDICTED: thioredoxin-like protein YLS8 isoform X2 [Brassica napus] gi|923888454|ref|XP_013715472.1| PREDICTED: thioredoxin-like protein YLS8 [Brassica napus] gi|674911508|emb|CDY21530.1| BnaC09g47620D [Brassica napus] gi|674963726|emb|CDX69958.1| BnaA10g23070D [Brassica napus] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >gb|EEC67208.1| hypothetical protein OsI_34094 [Oryza sativa Indica Group] Length = 274 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 367 KMSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 +MSYLLPHLHSGWAVDQAILAEEERLV+IRFGHDW Sbjct: 132 EMSYLLPHLHSGWAVDQAILAEEERLVIIRFGHDW 166 >gb|ACJ85953.1| unknown [Medicago truncatula] gi|388522237|gb|AFK49180.1| unknown [Medicago truncatula] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_006437597.1| hypothetical protein CICLE_v10033145mg [Citrus clementina] gi|568862096|ref|XP_006484526.1| PREDICTED: thioredoxin-like protein YLS8-like isoform X1 [Citrus sinensis] gi|557539793|gb|ESR50837.1| hypothetical protein CICLE_v10033145mg [Citrus clementina] gi|641833720|gb|KDO52729.1| hypothetical protein CISIN_1g032338mg [Citrus sinensis] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_004293898.1| PREDICTED: thioredoxin-like protein YLS8 [Fragaria vesca subsp. vesca] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_004148041.1| PREDICTED: thioredoxin-like protein YLS8 [Cucumis sativus] gi|502122515|ref|XP_004497782.1| PREDICTED: thioredoxin-like protein YLS8 [Cicer arietinum] gi|565461720|ref|XP_006288859.1| hypothetical protein CARUB_v10002214mg [Capsella rubella] gi|567171688|ref|XP_006399318.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum] gi|659115909|ref|XP_008457801.1| PREDICTED: thioredoxin-like protein YLS8 [Cucumis melo] gi|727561161|ref|XP_010452811.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] gi|727640273|ref|XP_010491455.1| PREDICTED: thioredoxin-like protein YLS8 [Camelina sativa] gi|823254441|ref|XP_012459864.1| PREDICTED: thioredoxin-like protein YLS8 [Gossypium raimondii] gi|317159581|gb|ADV04065.1| mitosis protein YLS8 [Hevea brasiliensis] gi|465111413|gb|AGH25793.1| YLS8 [Gossypium hirsutum] gi|482557565|gb|EOA21757.1| hypothetical protein CARUB_v10002214mg [Capsella rubella] gi|557100408|gb|ESQ40771.1| hypothetical protein EUTSA_v10014963mg [Eutrema salsugineum] gi|700206905|gb|KGN62024.1| hypothetical protein Csa_2G287060 [Cucumis sativus] gi|728819088|gb|KHG03038.1| Thioredoxin-like protein 4A [Gossypium arboreum] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_002871315.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] gi|297317152|gb|EFH47574.1| hypothetical protein ARALYDRAFT_908777 [Arabidopsis lyrata subsp. lyrata] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_003590204.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] gi|116782603|gb|ABK22569.1| unknown [Picea sitchensis] gi|116782987|gb|ABK22751.1| unknown [Picea sitchensis] gi|355479252|gb|AES60455.1| mRNA splicing factor, thioredoxin-like U5 snRNP protein [Medicago truncatula] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34 >ref|XP_002310072.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa] gi|225432821|ref|XP_002283622.1| PREDICTED: thioredoxin-like protein YLS8 [Vitis vinifera] gi|255577696|ref|XP_002529724.1| mitosis protein dim1, putative [Ricinus communis] gi|356532239|ref|XP_003534681.1| PREDICTED: DIM protein [Glycine max] gi|356571707|ref|XP_003554015.1| PREDICTED: thioredoxin-like protein YLS8-like [Glycine max] gi|586716637|ref|XP_006847846.1| PREDICTED: thioredoxin-like protein YLS8 [Amborella trichopoda] gi|590689614|ref|XP_007043276.1| MRNA splicing factor, thioredoxin-like U5 snRNP isoform 2 [Theobroma cacao] gi|694994943|ref|XP_009407394.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] gi|695050283|ref|XP_009413118.1| PREDICTED: thioredoxin-like protein YLS8 [Musa acuminata subsp. malaccensis] gi|702422206|ref|XP_010067004.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Eucalyptus grandis] gi|720060465|ref|XP_010274887.1| PREDICTED: thioredoxin-like protein YLS8 [Nelumbo nucifera] gi|743916542|ref|XP_011002244.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus euphratica] gi|743916546|ref|XP_011002246.1| PREDICTED: thioredoxin-like protein YLS8 isoform X1 [Populus euphratica] gi|769807396|ref|XP_011624634.1| PREDICTED: thioredoxin-like protein YLS8 [Amborella trichopoda] gi|802562828|ref|XP_012066576.1| PREDICTED: thioredoxin-like protein YLS8 [Jatropha curcas] gi|118484553|gb|ABK94150.1| unknown [Populus trichocarpa] gi|222852975|gb|EEE90522.1| hypothetical protein POPTR_0007s07660g [Populus trichocarpa] gi|223530788|gb|EEF32653.1| mitosis protein dim1, putative [Ricinus communis] gi|255629203|gb|ACU14946.1| unknown [Glycine max] gi|297737123|emb|CBI26324.3| unnamed protein product [Vitis vinifera] gi|508707211|gb|EOX99107.1| MRNA splicing factor, thioredoxin-like U5 snRNP isoform 2 [Theobroma cacao] gi|548851151|gb|ERN09427.1| hypothetical protein AMTR_s00029p00063040 [Amborella trichopoda] gi|643736219|gb|KDP42594.1| hypothetical protein JCGZ_24368 [Jatropha curcas] gi|734396264|gb|KHN29583.1| Thioredoxin-like protein 4A [Glycine soja] gi|734408320|gb|KHN34702.1| Thioredoxin-like protein 4A [Glycine soja] gi|947045196|gb|KRG94825.1| hypothetical protein GLYMA_19G111800 [Glycine max] gi|947092224|gb|KRH40889.1| hypothetical protein GLYMA_09G283300 [Glycine max] Length = 142 Score = 75.9 bits (185), Expect = 1e-11 Identities = 34/34 (100%), Positives = 34/34 (100%) Frame = +1 Query: 370 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 471 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW Sbjct: 1 MSYLLPHLHSGWAVDQAILAEEERLVVIRFGHDW 34