BLASTX nr result
ID: Papaver29_contig00040664
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00040664 (436 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010091720.1| Proteasome subunit alpha type-2-B [Morus not... 42 1e-05 >ref|XP_010091720.1| Proteasome subunit alpha type-2-B [Morus notabilis] gi|587855032|gb|EXB45048.1| Proteasome subunit alpha type-2-B [Morus notabilis] Length = 263 Score = 42.0 bits (97), Expect(2) = 1e-05 Identities = 20/30 (66%), Positives = 24/30 (80%) Frame = -2 Query: 417 KYWSCIQETIHITQLVRETAAIMQEFTQSG 328 +Y +E I +TQLVRETAA+MQEFTQSG Sbjct: 52 QYRRLYKEPIPVTQLVRETAAVMQEFTQSG 81 Score = 33.9 bits (76), Expect(2) = 1e-05 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = -3 Query: 329 GLRSFGVSLLVTGCDVNNPQLMMV 258 G+R FGVSLLV G D N PQL V Sbjct: 82 GVRPFGVSLLVAGFDDNGPQLFQV 105