BLASTX nr result
ID: Papaver29_contig00040105
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00040105 (824 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262231.1| PREDICTED: leucine-rich repeat extensin-like... 62 5e-07 >ref|XP_010262231.1| PREDICTED: leucine-rich repeat extensin-like protein 3 [Nelumbo nucifera] Length = 226 Score = 62.0 bits (149), Expect = 5e-07 Identities = 29/52 (55%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -2 Query: 778 GRRNERRKPGGE-INFGKKIGYLFIFVAGALQIGVISFLGFKRWKISKIRDR 626 G + +R KP + IN GKKIG LF VAG LQ+ V+ F+ FKRW++SKI+DR Sbjct: 172 GEKKQRTKPPDQTINIGKKIGLLFAGVAGVLQVAVVGFIVFKRWQVSKIKDR 223