BLASTX nr result
ID: Papaver29_contig00039145
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039145 (850 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002525169.1| conserved hypothetical protein [Ricinus comm... 59 3e-06 >ref|XP_002525169.1| conserved hypothetical protein [Ricinus communis] gi|223535466|gb|EEF37135.1| conserved hypothetical protein [Ricinus communis] Length = 90 Score = 59.3 bits (142), Expect = 3e-06 Identities = 33/68 (48%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +2 Query: 191 MGLKFGVAFGFILVLFLSRPILSQGIRSNVVELMKSDEIYEIDYRGPETHSKRIPPPDRS 370 MGLK F+L L L+ P +S+G + V +IYEIDYRGPETHS +PPP RS Sbjct: 1 MGLKSSFTSFFLLYLLLALPCISRGTEGSQVA---DSDIYEIDYRGPETHSSAMPPPGRS 57 Query: 371 -GNGHFNR 391 G NR Sbjct: 58 HGRPFINR 65