BLASTX nr result
ID: Papaver29_contig00039141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039141 (575 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014490555.1| PREDICTED: boron transporter 1-like isoform ... 75 3e-11 ref|XP_014490554.1| PREDICTED: boron transporter 1-like isoform ... 75 3e-11 ref|XP_007155436.1| hypothetical protein PHAVU_003G201100g [Phas... 75 3e-11 gb|KRH57080.1| hypothetical protein GLYMA_05G038300 [Glycine max] 74 4e-11 gb|KHN34321.1| Putative boron transporter 2 [Glycine soja] 74 4e-11 ref|XP_009376187.1| PREDICTED: probable boron transporter 2 [Pyr... 74 4e-11 ref|XP_009367178.1| PREDICTED: probable boron transporter 2 [Pyr... 74 4e-11 ref|XP_009363096.1| PREDICTED: probable boron transporter 2 [Pyr... 74 4e-11 ref|XP_008362547.1| PREDICTED: boron transporter 1-like [Malus d... 74 4e-11 ref|XP_002515224.1| Boron transporter, putative [Ricinus communi... 74 4e-11 ref|XP_003525432.1| PREDICTED: probable boron transporter 2-like... 74 4e-11 emb|CDY27507.1| BnaC04g51480D [Brassica napus] 74 5e-11 gb|KFK35411.1| hypothetical protein AALP_AA5G281100 [Arabis alpina] 74 5e-11 gb|ADF30180.1| boron transporter [Brassica napus] gi|294713702|g... 74 5e-11 gb|KOM32797.1| hypothetical protein LR48_Vigan01g235300 [Vigna a... 73 9e-11 gb|KDO69621.1| hypothetical protein CISIN_1g0051001mg, partial [... 73 9e-11 ref|XP_006476787.1| PREDICTED: probable boron transporter 2-like... 73 9e-11 ref|XP_012437934.1| PREDICTED: boron transporter 1-like [Gossypi... 73 1e-10 gb|KHG13958.1| Boron transporter 1 -like protein [Gossypium arbo... 73 1e-10 ref|XP_009138732.1| PREDICTED: probable boron transporter 2 [Bra... 73 1e-10 >ref|XP_014490555.1| PREDICTED: boron transporter 1-like isoform X2 [Vigna radiata var. radiata] Length = 671 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFQAGIRILA 38 >ref|XP_014490554.1| PREDICTED: boron transporter 1-like isoform X1 [Vigna radiata var. radiata] Length = 701 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFQAGIRILA 38 >ref|XP_007155436.1| hypothetical protein PHAVU_003G201100g [Phaseolus vulgaris] gi|561028790|gb|ESW27430.1| hypothetical protein PHAVU_003G201100g [Phaseolus vulgaris] Length = 671 Score = 74.7 bits (182), Expect = 3e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFQAGIRILA 38 >gb|KRH57080.1| hypothetical protein GLYMA_05G038300 [Glycine max] Length = 630 Score = 74.3 bits (181), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFRAGIRILA 38 >gb|KHN34321.1| Putative boron transporter 2 [Glycine soja] Length = 657 Score = 74.3 bits (181), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFRAGIRILA 38 >ref|XP_009376187.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri] Length = 713 Score = 74.3 bits (181), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPLQGIKND++GRLKCYK+DWT GF AG RILA Sbjct: 1 MEETFVPLQGIKNDLRGRLKCYKEDWTGGFKAGFRILA 38 >ref|XP_009367178.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri] gi|694382321|ref|XP_009367179.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri] Length = 713 Score = 74.3 bits (181), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPLQGIKND++GRLKCYK+DWT GF AG RILA Sbjct: 1 MEETFVPLQGIKNDLRGRLKCYKEDWTGGFKAGFRILA 38 >ref|XP_009363096.1| PREDICTED: probable boron transporter 2 [Pyrus x bretschneideri] Length = 713 Score = 74.3 bits (181), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPLQGIKND++GRLKCYK+DWT GF AG RILA Sbjct: 1 MEETFVPLQGIKNDLRGRLKCYKEDWTGGFKAGFRILA 38 >ref|XP_008362547.1| PREDICTED: boron transporter 1-like [Malus domestica] Length = 713 Score = 74.3 bits (181), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPLQGIKND++GRLKCYK+DWT GF AG RILA Sbjct: 1 MEETFVPLQGIKNDLRGRLKCYKEDWTGGFKAGFRILA 38 >ref|XP_002515224.1| Boron transporter, putative [Ricinus communis] gi|223545704|gb|EEF47208.1| Boron transporter, putative [Ricinus communis] Length = 717 Score = 74.3 bits (181), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND++GRL CYKQDWTSGF AGLRILA Sbjct: 1 MEETFVPLRGIKNDLRGRLLCYKQDWTSGFKAGLRILA 38 >ref|XP_003525432.1| PREDICTED: probable boron transporter 2-like [Glycine max] gi|947108753|gb|KRH57079.1| hypothetical protein GLYMA_05G038300 [Glycine max] Length = 680 Score = 74.3 bits (181), Expect = 4e-11 Identities = 33/38 (86%), Positives = 36/38 (94%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF AG+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFRAGIRILA 38 >emb|CDY27507.1| BnaC04g51480D [Brassica napus] Length = 702 Score = 73.9 bits (180), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRLKCYKQDWT GF AG RILA Sbjct: 1 MEETFVPFEGIKNDLKGRLKCYKQDWTGGFKAGFRILA 38 >gb|KFK35411.1| hypothetical protein AALP_AA5G281100 [Arabis alpina] Length = 705 Score = 73.9 bits (180), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRLKCYKQDWT GF AG RILA Sbjct: 1 MEETFVPFEGIKNDLKGRLKCYKQDWTGGFKAGFRILA 38 >gb|ADF30180.1| boron transporter [Brassica napus] gi|294713702|gb|ADF30188.1| boron transporter [Brassica napus] Length = 701 Score = 73.9 bits (180), Expect = 5e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRLKCYKQDWT GF AG RILA Sbjct: 1 MEETFVPFEGIKNDLKGRLKCYKQDWTGGFKAGFRILA 38 >gb|KOM32797.1| hypothetical protein LR48_Vigan01g235300 [Vigna angularis] Length = 671 Score = 73.2 bits (178), Expect = 9e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND+KGRL CYKQDWTSGF G+RILA Sbjct: 1 MEETFVPLRGIKNDLKGRLVCYKQDWTSGFQTGIRILA 38 >gb|KDO69621.1| hypothetical protein CISIN_1g0051001mg, partial [Citrus sinensis] Length = 617 Score = 73.2 bits (178), Expect = 9e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRLKCYKQDWT GF AG RILA Sbjct: 1 MEETFVPFRGIKNDLKGRLKCYKQDWTGGFRAGFRILA 38 >ref|XP_006476787.1| PREDICTED: probable boron transporter 2-like [Citrus sinensis] Length = 714 Score = 73.2 bits (178), Expect = 9e-11 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRLKCYKQDWT GF AG RILA Sbjct: 1 MEETFVPFRGIKNDLKGRLKCYKQDWTGGFRAGFRILA 38 >ref|XP_012437934.1| PREDICTED: boron transporter 1-like [Gossypium raimondii] gi|763782699|gb|KJB49770.1| hypothetical protein B456_008G137000 [Gossypium raimondii] Length = 710 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND++GRL CYKQDWTSGF AG RILA Sbjct: 1 MEETFVPLRGIKNDLRGRLLCYKQDWTSGFKAGFRILA 38 >gb|KHG13958.1| Boron transporter 1 -like protein [Gossypium arboreum] Length = 707 Score = 72.8 bits (177), Expect = 1e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVPL+GIKND++GRL CYKQDWTSGF AG RILA Sbjct: 1 MEETFVPLRGIKNDLRGRLLCYKQDWTSGFKAGFRILA 38 >ref|XP_009138732.1| PREDICTED: probable boron transporter 2 [Brassica rapa] Length = 707 Score = 72.8 bits (177), Expect = 1e-10 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -1 Query: 116 MEETFVPLQGIKNDIKGRLKCYKQDWTSGFSAGLRILA 3 MEETFVP +GIKND+KGRL+CYKQDWT GF AG RILA Sbjct: 1 MEETFVPFEGIKNDLKGRLRCYKQDWTGGFKAGFRILA 38