BLASTX nr result
ID: Papaver29_contig00039058
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039058 (780 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252929.1| PREDICTED: protein PHR1-LIKE 1-like isoform ... 59 3e-06 ref|XP_011040091.1| PREDICTED: myb family transcription factor A... 58 8e-06 >ref|XP_010252929.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera] gi|719990339|ref|XP_010252930.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera] gi|719990342|ref|XP_010252931.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera] gi|719990345|ref|XP_010252932.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera] gi|719990348|ref|XP_010252933.1| PREDICTED: protein PHR1-LIKE 1-like isoform X1 [Nelumbo nucifera] Length = 364 Score = 59.3 bits (142), Expect = 3e-06 Identities = 28/49 (57%), Positives = 34/49 (69%) Frame = -2 Query: 212 FSGATPKGVLRVMGVQGLTIYHVKSHLQDKEYLNSFPWASTSLISVQSK 66 F GATPKGVLR+MGVQGLTIYHVKSHLQ P +++ + + K Sbjct: 101 FEGATPKGVLRIMGVQGLTIYHVKSHLQKYRLAKYLPESTSDVKKSEKK 149 >ref|XP_011040091.1| PREDICTED: myb family transcription factor APL-like isoform X4 [Populus euphratica] Length = 265 Score = 57.8 bits (138), Expect = 8e-06 Identities = 30/47 (63%), Positives = 32/47 (68%) Frame = -2 Query: 206 GATPKGVLRVMGVQGLTIYHVKSHLQDKEYLNSFPWASTSLISVQSK 66 GATPKGVLRVMGVQGLTIYHVKSHLQ P +S+ V K Sbjct: 4 GATPKGVLRVMGVQGLTIYHVKSHLQKYRLAKYLPDSSSDGKKVDKK 50