BLASTX nr result
ID: Papaver29_contig00036497
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00036497 (406 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002528079.1| conserved hypothetical protein [Ricinus comm... 59 2e-06 ref|XP_011035102.1| PREDICTED: lisH domain and HEAT repeat-conta... 57 4e-06 ref|XP_002305839.2| hypothetical protein POPTR_0004s09500g [Popu... 57 4e-06 emb|CBI33619.3| unnamed protein product [Vitis vinifera] 56 9e-06 ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-conta... 56 9e-06 >ref|XP_002528079.1| conserved hypothetical protein [Ricinus communis] gi|223532540|gb|EEF34329.1| conserved hypothetical protein [Ricinus communis] Length = 1167 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/36 (77%), Positives = 29/36 (80%) Frame = +2 Query: 299 VTDQNLDILQKTPACVPYALRH*YYQYLSSIAVAVE 406 VTDQNLD+ Q TPACVP ALRH YYQYLSS A A E Sbjct: 178 VTDQNLDVWQNTPACVPDALRHYYYQYLSSTAEAAE 213 >ref|XP_011035102.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Populus euphratica] Length = 1181 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 299 VTDQNLDILQKTPACVPYALRH*YYQYLSSIAVAVE 406 VTDQNLD+ Q TPACVP ALRH YYQYLSS + A E Sbjct: 178 VTDQNLDVWQNTPACVPDALRHYYYQYLSSTSEAAE 213 >ref|XP_002305839.2| hypothetical protein POPTR_0004s09500g [Populus trichocarpa] gi|550340667|gb|EEE86350.2| hypothetical protein POPTR_0004s09500g [Populus trichocarpa] Length = 962 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/36 (75%), Positives = 29/36 (80%) Frame = +2 Query: 299 VTDQNLDILQKTPACVPYALRH*YYQYLSSIAVAVE 406 VTDQNLD+ Q TPACVP ALRH YYQYLSS + A E Sbjct: 178 VTDQNLDVWQNTPACVPDALRHYYYQYLSSTSEAAE 213 >emb|CBI33619.3| unnamed protein product [Vitis vinifera] Length = 1025 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 299 VTDQNLDILQKTPACVPYALRH*YYQYLSSIAVAVE 406 V DQNLD+ Q TPACVP ALRH YYQYLSS A A E Sbjct: 178 VIDQNLDVWQNTPACVPDALRHYYYQYLSSTAEAAE 213 >ref|XP_002281005.1| PREDICTED: lisH domain and HEAT repeat-containing protein KIAA1468 homolog [Vitis vinifera] Length = 1184 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = +2 Query: 299 VTDQNLDILQKTPACVPYALRH*YYQYLSSIAVAVE 406 V DQNLD+ Q TPACVP ALRH YYQYLSS A A E Sbjct: 178 VIDQNLDVWQNTPACVPDALRHYYYQYLSSTAEAAE 213