BLASTX nr result
ID: Papaver29_contig00036442
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00036442 (472 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDY15304.1| BnaC06g07900D [Brassica napus] 60 8e-07 emb|CEP10226.1| hypothetical protein [Parasitella parasitica] 59 1e-06 emb|CEP18377.1| hypothetical protein [Parasitella parasitica] 59 1e-06 dbj|GAN01168.1| 40S ribosomal protein S18 [Mucor ambiguus] 57 4e-06 dbj|GAN01528.1| 40S ribosomal protein S18 [Mucor ambiguus] 57 4e-06 dbj|GAN03332.1| 40S ribosomal protein S18, partial [Mucor ambiguus] 57 4e-06 gb|EPB92253.1| hypothetical protein HMPREF1544_00822 [Mucor circ... 57 4e-06 gb|EPB86574.1| 30S ribosomal protein S18e [Mucor circinelloides ... 57 4e-06 gb|EPB81165.1| 40S ribosomal protein S18 [Mucor circinelloides f... 57 4e-06 ref|XP_001422767.1| Ribosomal protein S18, component of cytosoli... 57 5e-06 ref|XP_005832131.1| small subunit ribosomal protein S18e_1, cyto... 57 7e-06 ref|XP_001696472.1| ribosomal protein S18, component of cytosoli... 57 7e-06 ref|XP_014512182.1| PREDICTED: 40S ribosomal protein S18-like [V... 56 9e-06 gb|KRH35135.1| hypothetical protein GLYMA_10G224200 [Glycine max] 56 9e-06 gb|KRG91660.1| hypothetical protein GLYMA_20G167600 [Glycine max] 56 9e-06 dbj|BAT00268.1| Os07g0174200, partial [Oryza sativa Japonica Group] 56 9e-06 ref|XP_013656096.1| PREDICTED: 40S ribosomal protein S18-like [B... 56 9e-06 ref|XP_013606957.1| PREDICTED: 40S ribosomal protein S18 [Brassi... 56 9e-06 gb|KOM55474.1| hypothetical protein LR48_Vigan10g136600, partial... 56 9e-06 gb|KOM35876.1| hypothetical protein LR48_Vigan02g202600 [Vigna a... 56 9e-06 >emb|CDY15304.1| BnaC06g07900D [Brassica napus] Length = 173 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/35 (71%), Positives = 28/35 (80%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K NHRGLRHYWGLRVRGQHTKTTG Sbjct: 127 LRDDLERLKKISRNHRGLRHYWGLRVRGQHTKTTG 161 >emb|CEP10226.1| hypothetical protein [Parasitella parasitica] Length = 209 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T+F ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 156 ISNVLDTKF--RDDLERLKKIR-NHRGLRHYWGIRVRGQHTKTTG 197 >emb|CEP18377.1| hypothetical protein [Parasitella parasitica] Length = 162 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T+F ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 109 ISNVLDTKF--RDDLERLKKIR-NHRGLRHYWGIRVRGQHTKTTG 150 >dbj|GAN01168.1| 40S ribosomal protein S18 [Mucor ambiguus] Length = 180 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 106 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 147 >dbj|GAN01528.1| 40S ribosomal protein S18 [Mucor ambiguus] Length = 147 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 101 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 142 >dbj|GAN03332.1| 40S ribosomal protein S18, partial [Mucor ambiguus] Length = 238 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 100 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 141 >gb|EPB92253.1| hypothetical protein HMPREF1544_00822 [Mucor circinelloides f. circinelloides 1006PhL] Length = 391 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 338 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 379 >gb|EPB86574.1| 30S ribosomal protein S18e [Mucor circinelloides f. circinelloides 1006PhL] Length = 167 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 114 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 155 >gb|EPB81165.1| 40S ribosomal protein S18 [Mucor circinelloides f. circinelloides 1006PhL] Length = 158 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/45 (60%), Positives = 35/45 (77%) Frame = +1 Query: 319 IEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 I +VL T++ ++ L+K + NHRGLRHYWG+RVRGQHTKTTG Sbjct: 105 ISNVLDTKY--RDDLERLKKIR-NHRGLRHYWGVRVRGQHTKTTG 146 >ref|XP_001422767.1| Ribosomal protein S18, component of cytosolic 80S ribosome and 40S small subunit [Ostreococcus lucimarinus CCE9901] gi|144583010|gb|ABP01084.1| Ribosomal protein S18, component of cytosolic 80S ribosome and 40S small subunit [Ostreococcus lucimarinus CCE9901] Length = 144 Score = 57.0 bits (136), Expect = 5e-06 Identities = 32/70 (45%), Positives = 41/70 (58%) Frame = +1 Query: 253 RSHNFTSLKLLQETRTLCELSCIEHVLQTRFILESSIQHLRK*KMNHRGLRHYWGLRVRG 432 R H+F K Q + + L T+ L ++ L+K + NHRGLRHYWG+RVRG Sbjct: 86 RKHDFKDGKFSQ---------LVSNQLDTK--LRDDLERLKKMR-NHRGLRHYWGIRVRG 133 Query: 433 QHTKTTGFSR 462 QHTKTTG R Sbjct: 134 QHTKTTGRGR 143 >ref|XP_005832131.1| small subunit ribosomal protein S18e_1, cytoplasmic [Guillardia theta CCMP2712] gi|428176266|gb|EKX45151.1| small subunit ribosomal protein S18e_1, cytoplasmic [Guillardia theta CCMP2712] Length = 155 Score = 56.6 bits (135), Expect = 7e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 + ++ L+K K NHRGLRHYWGLRVRGQHTKTTG Sbjct: 109 MRDDLERLKKIK-NHRGLRHYWGLRVRGQHTKTTG 142 >ref|XP_001696472.1| ribosomal protein S18, component of cytosolic 80S ribosome and 40S small subunit [Chlamydomonas reinhardtii] gi|158282697|gb|EDP08449.1| ribosomal protein S18 [Chlamydomonas reinhardtii] Length = 153 Score = 56.6 bits (135), Expect = 7e-06 Identities = 24/36 (66%), Positives = 30/36 (83%) Frame = +1 Query: 346 ILESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 ++ ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 107 VMRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 141 >ref|XP_014512182.1| PREDICTED: 40S ribosomal protein S18-like [Vigna radiata var. radiata] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 107 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 140 >gb|KRH35135.1| hypothetical protein GLYMA_10G224200 [Glycine max] Length = 181 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 136 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 169 >gb|KRG91660.1| hypothetical protein GLYMA_20G167600 [Glycine max] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 107 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 140 >dbj|BAT00268.1| Os07g0174200, partial [Oryza sativa Japonica Group] Length = 129 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 84 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 117 >ref|XP_013656096.1| PREDICTED: 40S ribosomal protein S18-like [Brassica napus] Length = 126 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 81 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 114 >ref|XP_013606957.1| PREDICTED: 40S ribosomal protein S18 [Brassica oleracea var. oleracea] gi|923693097|ref|XP_013657209.1| PREDICTED: 40S ribosomal protein S18-like [Brassica napus] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 107 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 140 >gb|KOM55474.1| hypothetical protein LR48_Vigan10g136600, partial [Vigna angularis] Length = 152 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 107 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 140 >gb|KOM35876.1| hypothetical protein LR48_Vigan02g202600 [Vigna angularis] Length = 153 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/35 (71%), Positives = 29/35 (82%) Frame = +1 Query: 349 LESSIQHLRK*KMNHRGLRHYWGLRVRGQHTKTTG 453 L ++ L+K + NHRGLRHYWGLRVRGQHTKTTG Sbjct: 108 LRDDLERLKKIR-NHRGLRHYWGLRVRGQHTKTTG 141