BLASTX nr result
ID: Papaver29_contig00035045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00035045 (969 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004486725.1| PREDICTED: pentatricopeptide repeat-containi... 64 2e-07 ref|XP_010654675.1| PREDICTED: pentatricopeptide repeat-containi... 63 3e-07 gb|ERN02213.1| hypothetical protein AMTR_s00045p00211940 [Ambore... 62 9e-07 ref|XP_008795043.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 61 1e-06 ref|XP_003597780.1| PPR containing plant-like protein [Medicago ... 61 1e-06 gb|KOM44538.1| hypothetical protein LR48_Vigan05g214300 [Vigna a... 60 3e-06 gb|KHN32603.1| Pentatricopeptide repeat-containing protein [Glyc... 60 3e-06 gb|KHG03594.1| hypothetical protein F383_26551 [Gossypium arboreum] 60 3e-06 ref|XP_006595138.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-06 ref|XP_003542104.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-06 ref|XP_012449977.1| PREDICTED: pentatricopeptide repeat-containi... 60 3e-06 ref|XP_007150666.1| hypothetical protein PHAVU_005G171500g [Phas... 60 3e-06 ref|XP_011466703.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-06 ref|XP_004302914.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-06 ref|XP_010915805.1| PREDICTED: pentatricopeptide repeat-containi... 58 1e-05 >ref|XP_004486725.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Cicer arietinum] Length = 638 Score = 63.5 bits (153), Expect = 2e-07 Identities = 32/44 (72%), Positives = 37/44 (84%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGED 218 G L+RA +FE AAKLMKEMSSKGFQYDLITYS IL+ + KV E+ Sbjct: 590 GCLSRAGLFEEAAKLMKEMSSKGFQYDLITYSSILEAVGKVDEE 633 >ref|XP_010654675.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Vitis vinifera] gi|297743291|emb|CBI36158.3| unnamed protein product [Vitis vinifera] Length = 638 Score = 63.2 bits (152), Expect = 3e-07 Identities = 31/48 (64%), Positives = 39/48 (81%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGEDNIDA 206 G L+RA +FE AAKLMKEM+SKGF+YDLITYS IL+ + K+ ED+ A Sbjct: 589 GCLSRAGMFEEAAKLMKEMNSKGFEYDLITYSSILEAVGKIDEDHTPA 636 >gb|ERN02213.1| hypothetical protein AMTR_s00045p00211940 [Amborella trichopoda] Length = 380 Score = 61.6 bits (148), Expect = 9e-07 Identities = 31/41 (75%), Positives = 35/41 (85%) Frame = -3 Query: 343 LNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 LNRA +FE AAK+MKEMS KGF+YDLITYS IL+ IRKV E Sbjct: 334 LNRAGMFEEAAKVMKEMSEKGFKYDLITYSSILEAIRKVDE 374 >ref|XP_008795043.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g16010 [Phoenix dactylifera] Length = 648 Score = 61.2 bits (147), Expect = 1e-06 Identities = 29/48 (60%), Positives = 39/48 (81%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGEDNIDA 206 G L+ A +FE AAKLMKEM SKGF+YDLITYS IL+ I K+ ++++D+ Sbjct: 599 GVLSHAGMFEEAAKLMKEMKSKGFEYDLITYSSILEAIGKIDDEHMDS 646 >ref|XP_003597780.1| PPR containing plant-like protein [Medicago truncatula] gi|355486828|gb|AES68031.1| PPR containing plant-like protein [Medicago truncatula] Length = 639 Score = 61.2 bits (147), Expect = 1e-06 Identities = 30/44 (68%), Positives = 36/44 (81%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGED 218 G L+RA +FE A KLMKEM+SKGF+YDLITYS IL+ + KV ED Sbjct: 590 GCLSRAGLFEEATKLMKEMNSKGFEYDLITYSSILEAVGKVDED 633 >gb|KOM44538.1| hypothetical protein LR48_Vigan05g214300 [Vigna angularis] Length = 640 Score = 60.1 bits (144), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA +FE AAKLM+EMSSKGFQYDLITYS IL+ + KV + Sbjct: 592 GCLSRAGLFEEAAKLMQEMSSKGFQYDLITYSSILEAVGKVDD 634 >gb|KHN32603.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 510 Score = 60.1 bits (144), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA +FE AAKLM+EMSSKGFQYDLITYS IL+ + KV + Sbjct: 462 GCLSRAGLFEEAAKLMQEMSSKGFQYDLITYSSILEAVGKVDD 504 >gb|KHG03594.1| hypothetical protein F383_26551 [Gossypium arboreum] Length = 641 Score = 60.1 bits (144), Expect = 3e-06 Identities = 29/45 (64%), Positives = 36/45 (80%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGEDN 215 G L+RA +FE A+KLMKEM + GF+YDLITYS IL+ + KV EDN Sbjct: 592 GCLSRAGMFEEASKLMKEMKASGFEYDLITYSSILEAVGKVDEDN 636 >ref|XP_006595138.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X2 [Glycine max] Length = 607 Score = 60.1 bits (144), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA +FE AAKLM+EMSSKGFQYDLITYS IL+ + KV + Sbjct: 559 GCLSRAGLFEEAAKLMQEMSSKGFQYDLITYSSILEAVGKVDD 601 >ref|XP_003542104.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010-like isoform X1 [Glycine max] gi|947074585|gb|KRH23476.1| hypothetical protein GLYMA_13G359600 [Glycine max] gi|947074586|gb|KRH23477.1| hypothetical protein GLYMA_13G359600 [Glycine max] Length = 631 Score = 60.1 bits (144), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA +FE AAKLM+EMSSKGFQYDLITYS IL+ + KV + Sbjct: 583 GCLSRAGLFEEAAKLMQEMSSKGFQYDLITYSSILEAVGKVDD 625 >ref|XP_012449977.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Gossypium raimondii] gi|763801187|gb|KJB68142.1| hypothetical protein B456_010G228100 [Gossypium raimondii] gi|763801188|gb|KJB68143.1| hypothetical protein B456_010G228100 [Gossypium raimondii] Length = 638 Score = 59.7 bits (143), Expect = 3e-06 Identities = 29/45 (64%), Positives = 35/45 (77%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGEDN 215 G L+RA +FE AAKLMKEM + GF+YDLITYS IL+ + K EDN Sbjct: 589 GCLSRAGMFEEAAKLMKEMKASGFEYDLITYSSILEAVGKADEDN 633 >ref|XP_007150666.1| hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] gi|561023930|gb|ESW22660.1| hypothetical protein PHAVU_005G171500g [Phaseolus vulgaris] Length = 632 Score = 59.7 bits (143), Expect = 3e-06 Identities = 30/43 (69%), Positives = 36/43 (83%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA +FE AAKLM+EMSSKGFQYDLITYS IL+ + KV + Sbjct: 584 GCLSRAGMFEEAAKLMQEMSSKGFQYDLITYSSILEAVGKVDD 626 >ref|XP_011466703.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X1 [Fragaria vesca subsp. vesca] Length = 672 Score = 59.3 bits (142), Expect = 4e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA + E AAKLMKEM+SKGFQYDLITYS IL+ + KV E Sbjct: 592 GCLSRAGLLEEAAKLMKEMTSKGFQYDLITYSSILEAVGKVDE 634 >ref|XP_004302914.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 isoform X2 [Fragaria vesca subsp. vesca] Length = 651 Score = 59.3 bits (142), Expect = 4e-06 Identities = 30/43 (69%), Positives = 35/43 (81%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGE 221 G L+RA + E AAKLMKEM+SKGFQYDLITYS IL+ + KV E Sbjct: 592 GCLSRAGLLEEAAKLMKEMTSKGFQYDLITYSSILEAVGKVDE 634 >ref|XP_010915805.1| PREDICTED: pentatricopeptide repeat-containing protein At3g16010 [Elaeis guineensis] Length = 645 Score = 58.2 bits (139), Expect = 1e-05 Identities = 28/47 (59%), Positives = 37/47 (78%) Frame = -3 Query: 349 GFLNRAKIFEAAAKLMKEMSSKGFQYDLITYSYILKDIRKVGEDNID 209 G L+ A +FE AAKLMKEM SKGF+YDLITYS +L+ I K+ ++ +D Sbjct: 596 GALSHAGMFEEAAKLMKEMKSKGFEYDLITYSSMLEAIGKIDDEPMD 642