BLASTX nr result
ID: Papaver29_contig00034048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00034048 (503 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004235949.1| PREDICTED: dnaJ homolog 1, mitochondrial [So... 57 7e-06 ref|XP_009603110.1| PREDICTED: dnaJ homolog subfamily A member 2... 56 9e-06 >ref|XP_004235949.1| PREDICTED: dnaJ homolog 1, mitochondrial [Solanum lycopersicum] Length = 498 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/32 (84%), Positives = 29/32 (90%) Frame = -1 Query: 98 RRFGGIVIRAAADYYSTLGVPKSATSKDIKAA 3 RRFG +V+ AAADYYSTLGVPKSA SKDIKAA Sbjct: 64 RRFGRLVVAAAADYYSTLGVPKSANSKDIKAA 95 >ref|XP_009603110.1| PREDICTED: dnaJ homolog subfamily A member 2 [Nicotiana tomentosiformis] Length = 510 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/32 (84%), Positives = 30/32 (93%) Frame = -1 Query: 98 RRFGGIVIRAAADYYSTLGVPKSATSKDIKAA 3 RRFG +V+ AAADYYSTLGVPKSA+SKDIKAA Sbjct: 77 RRFGRLVVVAAADYYSTLGVPKSASSKDIKAA 108