BLASTX nr result
ID: Papaver29_contig00033366
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00033366 (403 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267723.1| PREDICTED: mediator of RNA polymerase II tra... 67 5e-09 >ref|XP_010267723.1| PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Nelumbo nucifera] gi|720037602|ref|XP_010267724.1| PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Nelumbo nucifera] gi|720037605|ref|XP_010267726.1| PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Nelumbo nucifera] gi|720037608|ref|XP_010267727.1| PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Nelumbo nucifera] gi|720037611|ref|XP_010267728.1| PREDICTED: mediator of RNA polymerase II transcription subunit 4 [Nelumbo nucifera] Length = 427 Score = 67.0 bits (162), Expect = 5e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = -3 Query: 233 MLQNQSPQILQSPARLGLTNPNSPSFSNPATPKLNSQN 120 MLQ+ PQILQSPARLGLTNPNSPS NP+TPKL+SQN Sbjct: 1 MLQSHPPQILQSPARLGLTNPNSPSLPNPSTPKLSSQN 38