BLASTX nr result
ID: Papaver29_contig00032766
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00032766 (807 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010934240.1| PREDICTED: pre-mRNA-processing factor 19-lik... 58 7e-06 ref|XP_008785160.1| PREDICTED: U-box domain-containing protein 7... 58 7e-06 >ref|XP_010934240.1| PREDICTED: pre-mRNA-processing factor 19-like [Elaeis guineensis] Length = 509 Score = 58.2 bits (139), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 344 DALERYTLLSSHPVHKTNKPGILFVGIHPSK 252 DALERYT +SSHP+HKTNKPGIL V IHPSK Sbjct: 204 DALERYTQISSHPLHKTNKPGILSVDIHPSK 234 >ref|XP_008785160.1| PREDICTED: U-box domain-containing protein 72-like [Phoenix dactylifera] Length = 526 Score = 58.2 bits (139), Expect = 7e-06 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 344 DALERYTLLSSHPVHKTNKPGILFVGIHPSK 252 DALERYT +SSHP+HKTNKPGIL V IHPSK Sbjct: 204 DALERYTQISSHPLHKTNKPGILSVDIHPSK 234