BLASTX nr result
ID: Papaver29_contig00031146
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00031146 (520 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010274648.1| PREDICTED: U-box domain-containing protein 4... 79 2e-12 ref|XP_010260385.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 ref|XP_010260305.1| PREDICTED: U-box domain-containing protein 4... 72 2e-10 ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 2... 70 6e-10 ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 2... 70 6e-10 ref|XP_012832595.1| PREDICTED: U-box domain-containing protein 3... 68 2e-09 ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4... 68 2e-09 ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4... 68 2e-09 ref|XP_011097129.1| PREDICTED: U-box domain-containing protein 4... 66 9e-09 ref|XP_009762966.1| PREDICTED: U-box domain-containing protein 2... 65 2e-08 ref|XP_009611154.1| PREDICTED: U-box domain-containing protein 4... 64 3e-08 ref|XP_010660332.1| PREDICTED: U-box domain-containing protein 4... 63 8e-08 ref|XP_009627994.1| PREDICTED: U-box domain-containing protein 4... 63 8e-08 ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4... 63 8e-08 ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4... 63 1e-07 ref|XP_009617192.1| PREDICTED: U-box domain-containing protein 2... 62 1e-07 emb|CDP02708.1| unnamed protein product [Coffea canephora] 62 2e-07 ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4... 62 2e-07 ref|XP_010558679.1| PREDICTED: U-box domain-containing protein 3... 60 5e-07 ref|XP_010558676.1| PREDICTED: U-box domain-containing protein 3... 60 5e-07 >ref|XP_010274648.1| PREDICTED: U-box domain-containing protein 4-like [Nelumbo nucifera] Length = 381 Score = 78.6 bits (192), Expect = 2e-12 Identities = 47/77 (61%), Positives = 57/77 (74%), Gaps = 9/77 (11%) Frame = +3 Query: 312 MEPDSQISETDS---------KIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKY 464 ME +SQ S DS + IV+QT+EL IQS+DP S+IQAA++IRRLTKTSQ+Y Sbjct: 1 MELESQFSGDDSSNSFGANTARTSAIVSQTIEL-IQSDDPVSRIQAAREIRRLTKTSQRY 59 Query: 465 RRHFSGAIQYLVSMLRS 515 RR FSGAI+ LVSMLRS Sbjct: 60 RRQFSGAIEPLVSMLRS 76 >ref|XP_010260385.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Nelumbo nucifera] Length = 381 Score = 72.0 bits (175), Expect = 2e-10 Identities = 45/78 (57%), Positives = 55/78 (70%), Gaps = 9/78 (11%) Frame = +3 Query: 312 MEPDSQISETDS---------KIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKY 464 ME +SQ S DS + IV QT+EL IQS D SKIQAA++IRRLTKTSQK+ Sbjct: 1 MESESQFSGDDSSRNLGASTVRKSAIVKQTIEL-IQSEDTESKIQAAREIRRLTKTSQKH 59 Query: 465 RRHFSGAIQYLVSMLRSN 518 RR FSGAI+ L+SML+S+ Sbjct: 60 RRQFSGAIEPLLSMLKSD 77 >ref|XP_010260305.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Nelumbo nucifera] Length = 420 Score = 72.0 bits (175), Expect = 2e-10 Identities = 45/78 (57%), Positives = 55/78 (70%), Gaps = 9/78 (11%) Frame = +3 Query: 312 MEPDSQISETDS---------KIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKY 464 ME +SQ S DS + IV QT+EL IQS D SKIQAA++IRRLTKTSQK+ Sbjct: 1 MESESQFSGDDSSRNLGASTVRKSAIVKQTIEL-IQSEDTESKIQAAREIRRLTKTSQKH 59 Query: 465 RRHFSGAIQYLVSMLRSN 518 RR FSGAI+ L+SML+S+ Sbjct: 60 RRQFSGAIEPLLSMLKSD 77 >ref|XP_004231992.1| PREDICTED: U-box domain-containing protein 2 isoform X2 [Solanum lycopersicum] Length = 373 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 V QT+ LIQS+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRS 84 >ref|XP_004231991.1| PREDICTED: U-box domain-containing protein 2 isoform X1 [Solanum lycopersicum] Length = 389 Score = 70.1 bits (170), Expect = 6e-10 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 V QT+ LIQS+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS Sbjct: 35 VQQTL-FLIQSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRS 84 >ref|XP_012832595.1| PREDICTED: U-box domain-containing protein 3 [Erythranthe guttatus] gi|604342267|gb|EYU41331.1| hypothetical protein MIMGU_mgv1a008704mg [Erythranthe guttata] Length = 365 Score = 68.2 bits (165), Expect = 2e-09 Identities = 37/60 (61%), Positives = 45/60 (75%) Frame = +3 Query: 333 SETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLR 512 S S VNQT+ +L+QS+DP S++ AAKDIRRLTKTSQ+ RRHFSGA+ LV MLR Sbjct: 10 SSLSSSSAATVNQTL-VLLQSDDPNSRVLAAKDIRRLTKTSQRSRRHFSGAVGPLVDMLR 68 >ref|XP_006357777.1| PREDICTED: U-box domain-containing protein 4-like isoform X2 [Solanum tuberosum] Length = 373 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 V QT+ LI S+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRS 84 >ref|XP_006357776.1| PREDICTED: U-box domain-containing protein 4-like isoform X1 [Solanum tuberosum] Length = 389 Score = 68.2 bits (165), Expect = 2e-09 Identities = 35/51 (68%), Positives = 42/51 (82%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 V QT+ LI S+DP K+QAAK+IRRLTKTSQ+YRRHFS A++ LV MLRS Sbjct: 35 VQQTL-FLIHSDDPTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLVDMLRS 84 >ref|XP_011097129.1| PREDICTED: U-box domain-containing protein 4 [Sesamum indicum] Length = 394 Score = 66.2 bits (160), Expect = 9e-09 Identities = 33/49 (67%), Positives = 42/49 (85%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSML 509 V QT+ +L++S+DP ++QAAKDIRRLTKTSQ+YRRHFSGA+ LV ML Sbjct: 40 VTQTL-MLLESDDPNLRVQAAKDIRRLTKTSQRYRRHFSGAVGPLVDML 87 >ref|XP_009762966.1| PREDICTED: U-box domain-containing protein 2-like [Nicotiana sylvestris] Length = 388 Score = 65.1 bits (157), Expect = 2e-08 Identities = 38/65 (58%), Positives = 45/65 (69%) Frame = +3 Query: 321 DSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLV 500 D I T S V QT+ LI S+D K+QAAK+IRRLTKTSQ+YRRHFS A++ LV Sbjct: 22 DGPIRRTTSS--SAVQQTL-FLIHSDDLTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLV 78 Query: 501 SMLRS 515 MLRS Sbjct: 79 DMLRS 83 >ref|XP_009611154.1| PREDICTED: U-box domain-containing protein 45-like [Nicotiana tomentosiformis] Length = 372 Score = 64.3 bits (155), Expect = 3e-08 Identities = 33/51 (64%), Positives = 43/51 (84%) Frame = +3 Query: 363 VNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 VN+ + LLIQS+DP K+QAA +IRRLTKTS++YRR+FS A++ LV MLRS Sbjct: 20 VNRNL-LLIQSDDPILKVQAAMEIRRLTKTSKRYRRYFSNAVKPLVDMLRS 69 >ref|XP_010660332.1| PREDICTED: U-box domain-containing protein 4 isoform X1 [Vitis vinifera] Length = 381 Score = 63.2 bits (152), Expect = 8e-08 Identities = 38/66 (57%), Positives = 49/66 (74%) Frame = +3 Query: 315 EPDSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQY 494 +PD+ + T + VN+T+ LL QS+DP S+IQAAK+IRRLTKTSQK RR S A++ Sbjct: 13 DPDTPRTATTA-----VNRTLHLL-QSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRP 66 Query: 495 LVSMLR 512 LVSMLR Sbjct: 67 LVSMLR 72 >ref|XP_009627994.1| PREDICTED: U-box domain-containing protein 4-like [Nicotiana tomentosiformis] Length = 360 Score = 63.2 bits (152), Expect = 8e-08 Identities = 32/52 (61%), Positives = 41/52 (78%) Frame = +3 Query: 360 IVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRS 515 IV +T+ L+QS DP K+Q A+DIRRLTK+S +YRRHFS A++ LV MLRS Sbjct: 5 IVEKTL-YLVQSEDPILKVQGARDIRRLTKSSLRYRRHFSDAVKPLVDMLRS 55 >ref|XP_002273909.1| PREDICTED: U-box domain-containing protein 4 isoform X2 [Vitis vinifera] gi|147807233|emb|CAN61950.1| hypothetical protein VITISV_002189 [Vitis vinifera] Length = 378 Score = 63.2 bits (152), Expect = 8e-08 Identities = 38/66 (57%), Positives = 49/66 (74%) Frame = +3 Query: 315 EPDSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQY 494 +PD+ + T + VN+T+ LL QS+DP S+IQAAK+IRRLTKTSQK RR S A++ Sbjct: 13 DPDTPRTATTA-----VNRTLHLL-QSDDPDSQIQAAKEIRRLTKTSQKCRRQLSPAVRP 66 Query: 495 LVSMLR 512 LVSMLR Sbjct: 67 LVSMLR 72 >ref|XP_006364015.1| PREDICTED: U-box domain-containing protein 4-like [Solanum tuberosum] Length = 361 Score = 62.8 bits (151), Expect = 1e-07 Identities = 32/53 (60%), Positives = 43/53 (81%) Frame = +3 Query: 360 IVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSN 518 IV +T+ LIQS+DP K+Q A+DIRRLTK+S +YRRHFS A++ LV MLR++ Sbjct: 5 IVEKTL-YLIQSDDPILKLQGARDIRRLTKSSLRYRRHFSDAVKPLVDMLRNS 56 >ref|XP_009617192.1| PREDICTED: U-box domain-containing protein 2 [Nicotiana tomentosiformis] Length = 390 Score = 62.4 bits (150), Expect = 1e-07 Identities = 37/65 (56%), Positives = 44/65 (67%) Frame = +3 Query: 321 DSQISETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLV 500 D I T S V QT+ LI S+D K+QAAK+IRRLTKTSQ+YRRHFS A++ LV Sbjct: 24 DGDIRRTTSS--SAVQQTL-FLIHSDDLTLKVQAAKEIRRLTKTSQRYRRHFSNAVKPLV 80 Query: 501 SMLRS 515 ML S Sbjct: 81 DMLCS 85 >emb|CDP02708.1| unnamed protein product [Coffea canephora] Length = 188 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/74 (47%), Positives = 49/74 (66%), Gaps = 3/74 (4%) Frame = +3 Query: 297 TANRKMEPDSQI---SETDSKIPEIVNQTMELLIQSNDPCSKIQAAKDIRRLTKTSQKYR 467 T PD+ + S + SK+ EI++ LIQS+D K++AA++IRRL KTSQ+YR Sbjct: 21 TTTAGASPDTDVPLRSPSPSKVSEILH-----LIQSDDLQQKVEAAREIRRLAKTSQRYR 75 Query: 468 RHFSGAIQYLVSML 509 RHFS A++ LV ML Sbjct: 76 RHFSDAVKPLVQML 89 >ref|XP_004233479.1| PREDICTED: U-box domain-containing protein 4-like [Solanum lycopersicum] Length = 419 Score = 61.6 bits (148), Expect = 2e-07 Identities = 30/46 (65%), Positives = 39/46 (84%) Frame = +3 Query: 381 LLIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSN 518 LLIQS+D K+QAA++IRRLTKTS++YRR+FS A++ LV ML SN Sbjct: 74 LLIQSDDLTLKVQAAREIRRLTKTSKRYRRYFSNAVKSLVHMLHSN 119 >ref|XP_010558679.1| PREDICTED: U-box domain-containing protein 3-like isoform X2 [Tarenaya hassleriana] Length = 411 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +3 Query: 384 LIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSN 518 LI SNDP S+ AA +IRRLTKTSQ+YRRH S A++ LVSMLR++ Sbjct: 55 LIGSNDPDSRFFAASEIRRLTKTSQRYRRHLSQAVESLVSMLRAD 99 >ref|XP_010558676.1| PREDICTED: U-box domain-containing protein 3-like isoform X1 [Tarenaya hassleriana] Length = 447 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/45 (66%), Positives = 37/45 (82%) Frame = +3 Query: 384 LIQSNDPCSKIQAAKDIRRLTKTSQKYRRHFSGAIQYLVSMLRSN 518 LI SNDP S+ AA +IRRLTKTSQ+YRRH S A++ LVSMLR++ Sbjct: 55 LIGSNDPDSRFFAASEIRRLTKTSQRYRRHLSQAVESLVSMLRAD 99