BLASTX nr result
ID: Papaver29_contig00030935
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00030935 (679 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004299483.1| PREDICTED: homeobox-leucine zipper protein H... 51 1e-08 ref|XP_010932508.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leu... 54 2e-08 ref|XP_008789231.1| PREDICTED: homeobox-leucine zipper protein R... 54 2e-08 ref|XP_008789232.1| PREDICTED: homeobox-leucine zipper protein R... 54 2e-08 ref|XP_008789233.1| PREDICTED: homeobox-leucine zipper protein R... 54 2e-08 ref|XP_014505752.1| PREDICTED: homeobox-leucine zipper protein H... 52 2e-08 gb|KOM54559.1| hypothetical protein LR48_Vigan10g045100 [Vigna a... 52 2e-08 ref|XP_007152598.1| hypothetical protein PHAVU_004G143500g [Phas... 52 2e-08 ref|XP_010917295.1| PREDICTED: homeobox-leucine zipper protein R... 53 3e-08 ref|XP_010268321.1| PREDICTED: homeobox-leucine zipper protein H... 53 3e-08 ref|XP_010268322.1| PREDICTED: homeobox-leucine zipper protein H... 53 3e-08 gb|KMZ59789.1| Homeobox-leucine zipper protein ROC8 [Zostera mar... 53 4e-08 ref|XP_006374213.1| homeobox-leucine zipper family protein [Popu... 50 5e-08 gb|AIA58891.1| homeodomain protein HOX3-A [Gossypium hirsutum] 50 5e-08 gb|AAU12247.1| homeodomain protein HOX3 [Gossypium hirsutum] 50 5e-08 ref|XP_011035552.1| PREDICTED: homeobox-leucine zipper protein H... 50 5e-08 ref|XP_006374212.1| hypothetical protein POPTR_0015s05050g [Popu... 50 5e-08 ref|XP_008445879.1| PREDICTED: homeobox-leucine zipper protein H... 49 1e-07 ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein H... 49 1e-07 ref|XP_011649564.1| PREDICTED: homeobox-leucine zipper protein H... 49 1e-07 >ref|XP_004299483.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Fragaria vesca subsp. vesca] Length = 709 Score = 50.8 bits (120), Expect(3) = 1e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FKDCPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 36 AMFKDCPHPDEKQRLQLSRELGLAPRQIKFWFQ 68 Score = 32.3 bits (72), Expect(3) = 1e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 65 FWFQNRRTQMKAQH 78 Score = 22.7 bits (47), Expect(3) = 1e-08 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 154 KAQHERAYNSV 122 KAQHERA NSV Sbjct: 75 KAQHERADNSV 85 >ref|XP_010932508.1| PREDICTED: LOW QUALITY PROTEIN: homeobox-leucine zipper protein ROC8-like [Elaeis guineensis] Length = 722 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 32 AVFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_008789231.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X1 [Phoenix dactylifera] Length = 722 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 32 AVFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_008789232.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X2 [Phoenix dactylifera] Length = 697 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 32 AVFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_008789233.1| PREDICTED: homeobox-leucine zipper protein ROC8-like isoform X3 [Phoenix dactylifera] Length = 671 Score = 53.9 bits (128), Expect(2) = 2e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 32 AVFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_014505752.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Vigna radiata var. radiata] Length = 715 Score = 51.6 bits (122), Expect(3) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQRMQL+R+LGL P QI F+ Sbjct: 41 SMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQ 73 Score = 32.3 bits (72), Expect(3) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 70 FWFQNRRTQMKAQH 83 Score = 21.2 bits (43), Expect(3) = 2e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 80 KAQHERADNS 89 >gb|KOM54559.1| hypothetical protein LR48_Vigan10g045100 [Vigna angularis] Length = 715 Score = 51.6 bits (122), Expect(3) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQRMQL+R+LGL P QI F+ Sbjct: 41 SMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQ 73 Score = 32.3 bits (72), Expect(3) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 70 FWFQNRRTQMKAQH 83 Score = 21.2 bits (43), Expect(3) = 2e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 80 KAQHERADNS 89 >ref|XP_007152598.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris] gi|561025907|gb|ESW24592.1| hypothetical protein PHAVU_004G143500g [Phaseolus vulgaris] Length = 715 Score = 51.6 bits (122), Expect(3) = 2e-08 Identities = 22/33 (66%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQRMQL+R+LGL P QI F+ Sbjct: 41 SMFKECPHPDEKQRMQLSRELGLAPRQIKFWFQ 73 Score = 32.3 bits (72), Expect(3) = 2e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 70 FWFQNRRTQMKAQH 83 Score = 21.2 bits (43), Expect(3) = 2e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 80 KAQHERADNS 89 >ref|XP_010917295.1| PREDICTED: homeobox-leucine zipper protein ROC8-like [Elaeis guineensis] Length = 727 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 32 AMFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_010268321.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Nelumbo nucifera] Length = 706 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 38 AMFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 70 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 67 FWFQNRRTQMKAQH 80 >ref|XP_010268322.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Nelumbo nucifera] Length = 667 Score = 53.1 bits (126), Expect(2) = 3e-08 Identities = 22/33 (66%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRMQL+RDLGL+P QI F+ Sbjct: 38 AMFKECPHPDEKQRMQLSRDLGLEPRQIKFWFQ 70 Score = 32.3 bits (72), Expect(2) = 3e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 67 FWFQNRRTQMKAQH 80 >gb|KMZ59789.1| Homeobox-leucine zipper protein ROC8 [Zostera marina] Length = 692 Score = 52.8 bits (125), Expect(2) = 4e-08 Identities = 21/33 (63%), Positives = 29/33 (87%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQRM+L+RDLGL+P QI F+ Sbjct: 32 AVFKECPHPDEKQRMELSRDLGLEPKQIKFWFQ 64 Score = 32.3 bits (72), Expect(2) = 4e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 61 FWFQNRRTQMKAQH 74 >ref|XP_006374213.1| homeobox-leucine zipper family protein [Populus trichocarpa] gi|550321970|gb|ERP52010.1| homeobox-leucine zipper family protein [Populus trichocarpa] Length = 725 Score = 50.4 bits (119), Expect(3) = 5e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 43 SMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 75 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 72 FWFQNRRTQMKAQH 85 Score = 21.2 bits (43), Expect(3) = 5e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 82 KAQHERADNS 91 >gb|AIA58891.1| homeodomain protein HOX3-A [Gossypium hirsutum] Length = 713 Score = 50.4 bits (119), Expect(3) = 5e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 44 SMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 76 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 73 FWFQNRRTQMKAQH 86 Score = 21.2 bits (43), Expect(3) = 5e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 83 KAQHERADNS 92 >gb|AAU12247.1| homeodomain protein HOX3 [Gossypium hirsutum] Length = 713 Score = 50.4 bits (119), Expect(3) = 5e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 44 SMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 76 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 73 FWFQNRRTQMKAQH 86 Score = 21.2 bits (43), Expect(3) = 5e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 83 KAQHERADNS 92 >ref|XP_011035552.1| PREDICTED: homeobox-leucine zipper protein HDG11 [Populus euphratica] Length = 707 Score = 50.4 bits (119), Expect(3) = 5e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 43 SMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 75 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 72 FWFQNRRTQMKAQH 85 Score = 21.2 bits (43), Expect(3) = 5e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 82 KAQHERADNS 91 >ref|XP_006374212.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa] gi|550321969|gb|ERP52009.1| hypothetical protein POPTR_0015s05050g [Populus trichocarpa] Length = 707 Score = 50.4 bits (119), Expect(3) = 5e-08 Identities = 21/33 (63%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 S+FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 43 SMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 75 Score = 32.3 bits (72), Expect(3) = 5e-08 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 72 FWFQNRRTQMKAQH 85 Score = 21.2 bits (43), Expect(3) = 5e-08 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 82 KAQHERADNS 91 >ref|XP_008445879.1| PREDICTED: homeobox-leucine zipper protein HDG11-like [Cucumis melo] Length = 1107 Score = 49.3 bits (116), Expect(3) = 1e-07 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 37 AMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 69 Score = 32.3 bits (72), Expect(3) = 1e-07 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 66 FWFQNRRTQMKAQH 79 Score = 21.2 bits (43), Expect(3) = 1e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 76 KAQHERADNS 85 >ref|XP_004137568.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X1 [Cucumis sativus] gi|700208855|gb|KGN63951.1| hypothetical protein Csa_1G031750 [Cucumis sativus] Length = 705 Score = 49.3 bits (116), Expect(3) = 1e-07 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 37 AMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 69 Score = 32.3 bits (72), Expect(3) = 1e-07 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 66 FWFQNRRTQMKAQH 79 Score = 21.2 bits (43), Expect(3) = 1e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 76 KAQHERADNS 85 >ref|XP_011649564.1| PREDICTED: homeobox-leucine zipper protein HDG11-like isoform X2 [Cucumis sativus] Length = 601 Score = 49.3 bits (116), Expect(3) = 1e-07 Identities = 20/33 (60%), Positives = 28/33 (84%) Frame = -3 Query: 356 SIFKDCPHPEEKQRMQLNRDLGLQPCQINSGFR 258 ++FK+CPHP+EKQR+QL+R+LGL P QI F+ Sbjct: 37 AMFKECPHPDEKQRLQLSRELGLAPRQIKFWFQ 69 Score = 32.3 bits (72), Expect(3) = 1e-07 Identities = 12/14 (85%), Positives = 12/14 (85%) Frame = -2 Query: 270 FWFQNRRTQMKTNH 229 FWFQNRRTQMK H Sbjct: 66 FWFQNRRTQMKAQH 79 Score = 21.2 bits (43), Expect(3) = 1e-07 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = -1 Query: 154 KAQHERAYNS 125 KAQHERA NS Sbjct: 76 KAQHERADNS 85