BLASTX nr result
ID: Papaver29_contig00030897
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00030897 (736 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011083058.1| PREDICTED: histone-lysine N-methyltransferas... 57 1e-05 >ref|XP_011083058.1| PREDICTED: histone-lysine N-methyltransferase SUVR2 [Sesamum indicum] gi|747072305|ref|XP_011083059.1| PREDICTED: histone-lysine N-methyltransferase SUVR2 [Sesamum indicum] gi|747072307|ref|XP_011083060.1| PREDICTED: histone-lysine N-methyltransferase SUVR2 [Sesamum indicum] Length = 883 Score = 57.4 bits (137), Expect = 1e-05 Identities = 41/90 (45%), Positives = 51/90 (56%), Gaps = 2/90 (2%) Frame = -1 Query: 280 INFEDRGRGSLLA--PTICKRSERETPTAPFVVCLKQPKTEPGVEPLPPKEKLASGAQTK 107 I DRG+GS P+ +RS RE+ + VCLK+PK EPG+ L PKEK +SG Sbjct: 228 IGLRDRGKGSDYPQIPSGEERSVRES--SRHAVCLKEPKVEPGI-ILSPKEK-SSGCH-- 281 Query: 106 VLVKPKTEPCNDGFQPSGVPAAATLPPNPD 17 L+KPK EP D F P VP A P + D Sbjct: 282 ALIKPKDEPVTDVFLPLEVPLAVIHPDSSD 311