BLASTX nr result
ID: Papaver29_contig00029494
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00029494 (551 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002309354.2| hypothetical protein POPTR_0006s19660g [Popu... 60 9e-07 >ref|XP_002309354.2| hypothetical protein POPTR_0006s19660g [Populus trichocarpa] gi|550336668|gb|EEE92877.2| hypothetical protein POPTR_0006s19660g [Populus trichocarpa] Length = 269 Score = 59.7 bits (143), Expect = 9e-07 Identities = 29/68 (42%), Positives = 43/68 (63%), Gaps = 6/68 (8%) Frame = -2 Query: 466 YWCEQCQVGCKSEKTLVNHEKGKKHMARLRVAKQDVDAVQA------SEANIGKAEAVEV 305 +WCE CQ+G SE + H+KGKKH+ARL+ + Q+ +AVQA SE + + E E Sbjct: 153 FWCEMCQIGAYSEMVMEAHKKGKKHLARLQKSSQNGEAVQADKKAKDSEVAVKETEDSEF 212 Query: 304 VNQEATEN 281 V + AT++ Sbjct: 213 VAERATDS 220