BLASTX nr result
ID: Papaver29_contig00024018
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00024018 (1262 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010255738.1| PREDICTED: formin-binding protein 4-like iso... 60 4e-06 ref|XP_010255737.1| PREDICTED: formin-binding protein 4-like iso... 60 4e-06 >ref|XP_010255738.1| PREDICTED: formin-binding protein 4-like isoform X2 [Nelumbo nucifera] Length = 976 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 1260 KHQDNPLLLFGQYSDDELNDEENKRPKHDVSESSSIEQKSQV 1135 +HQ+NPLLL GQYSDDEL DE NK K+DV+E+S IE QV Sbjct: 28 QHQENPLLLLGQYSDDELEDESNKGLKNDVTENSLIEDNGQV 69 >ref|XP_010255737.1| PREDICTED: formin-binding protein 4-like isoform X1 [Nelumbo nucifera] Length = 1009 Score = 60.1 bits (144), Expect = 4e-06 Identities = 28/42 (66%), Positives = 33/42 (78%) Frame = -3 Query: 1260 KHQDNPLLLFGQYSDDELNDEENKRPKHDVSESSSIEQKSQV 1135 +HQ+NPLLL GQYSDDEL DE NK K+DV+E+S IE QV Sbjct: 61 QHQENPLLLLGQYSDDELEDESNKGLKNDVTENSLIEDNGQV 102