BLASTX nr result
ID: Papaver29_contig00021070
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00021070 (658 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KOM26861.1| hypothetical protein LR48_Vigan325s003300 [Vigna ... 63 5e-14 ref|XP_014506960.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 ref|XP_003532520.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 ref|XP_003525226.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 ref|XP_006574818.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 ref|XP_006583719.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 gb|KHN21612.1| Microtubule-associated protein 70-2 [Glycine soja] 63 5e-14 ref|XP_007153235.1| hypothetical protein PHAVU_003G018100g [Phas... 63 5e-14 ref|XP_014521042.1| PREDICTED: microtubule-associated protein 70... 63 5e-14 gb|KOM46262.1| hypothetical protein LR48_Vigan06g156800 [Vigna a... 63 5e-14 gb|KHN23795.1| Microtubule-associated protein 70-2 [Glycine soja] 63 5e-14 gb|KHN15454.1| Microtubule-associated protein 70-2 [Glycine soja] 63 5e-14 gb|KMZ63923.1| microtubule-associated proteins 70-2 [Zostera mar... 64 7e-14 ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70... 61 9e-14 ref|XP_010088195.1| hypothetical protein L484_005541 [Morus nota... 64 1e-13 ref|XP_004239261.1| PREDICTED: microtubule-associated protein 70... 62 1e-13 ref|XP_010273713.1| PREDICTED: microtubule-associated protein 70... 64 2e-13 ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70... 61 2e-13 ref|XP_009417688.1| PREDICTED: microtubule-associated protein 70... 63 2e-13 ref|XP_009777395.1| PREDICTED: microtubule-associated protein 70... 62 2e-13 >gb|KOM26861.1| hypothetical protein LR48_Vigan325s003300 [Vigna angularis] Length = 643 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 46 DADEFMNLLHGSDPVKVELNRLENEVRDKD 75 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 79 SEAQAEIKALRLSERLREKAVEEL 102 >ref|XP_014506960.1| PREDICTED: microtubule-associated protein 70-2-like [Vigna radiata var. radiata] Length = 616 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 46 DADEFMNLLHGSDPVKVELNRLENEVRDKD 75 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 79 SEAQAEIKALRLSERLREKAVEEL 102 >ref|XP_003532520.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine max] gi|947093135|gb|KRH41720.1| hypothetical protein GLYMA_08G046200 [Glycine max] Length = 616 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 46 DADEFMNLLHGSDPVKVELNRLENEVRDKD 75 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 79 SEAQAEIKALRLSERLREKAVEEL 102 >ref|XP_003525226.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine max] gi|947112093|gb|KRH60419.1| hypothetical protein GLYMA_05G239100 [Glycine max] Length = 616 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 46 DADEFMNLLHGSDPVKVELNRLENEVRDKD 75 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 79 SEAQAEIKALRLSERLREKAVEEL 102 >ref|XP_006574818.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine max] gi|947122148|gb|KRH70354.1| hypothetical protein GLYMA_02G085500 [Glycine max] Length = 612 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 41 DADEFMNLLHGSDPVKVELNRLENEVRDKD 70 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 74 SEAQAEIKALRLSERLREKAVEEL 97 >ref|XP_006583719.1| PREDICTED: microtubule-associated protein 70-2-like [Glycine max] gi|947101165|gb|KRH49657.1| hypothetical protein GLYMA_07G170700 [Glycine max] gi|947101166|gb|KRH49658.1| hypothetical protein GLYMA_07G170700 [Glycine max] Length = 611 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 40 DADEFMNLLHGSDPVKVELNRLENEVRDKD 69 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 73 SEAQAEIKALRLSERLREKAVEEL 96 >gb|KHN21612.1| Microtubule-associated protein 70-2 [Glycine soja] Length = 609 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 39 DADEFMNLLHGSDPVKVELNRLENEVRDKD 68 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 72 SEAQAEIKALRLSERLREKAVEEL 95 >ref|XP_007153235.1| hypothetical protein PHAVU_003G018100g [Phaseolus vulgaris] gi|561026589|gb|ESW25229.1| hypothetical protein PHAVU_003G018100g [Phaseolus vulgaris] Length = 605 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 36 DADEFMNLLHGSDPVKVELNRLENEVRDKD 65 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 69 SEAQAEIKALRLSERLREKAVEEL 92 >ref|XP_014521042.1| PREDICTED: microtubule-associated protein 70-2-like [Vigna radiata var. radiata] Length = 589 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 20 DADEFMNLLHGSDPVKVELNRLENEVRDKD 49 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 53 SEAQAEIKALRLSERLREKAVEEL 76 >gb|KOM46262.1| hypothetical protein LR48_Vigan06g156800 [Vigna angularis] Length = 577 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 20 DADEFMNLLHGSDPVKVELNRLENEVRDKD 49 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 53 SEAQAEIKALRLSERLREKAVEEL 76 >gb|KHN23795.1| Microtubule-associated protein 70-2 [Glycine soja] Length = 573 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 2 DADEFMNLLHGSDPVKVELNRLENEVRDKD 31 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 35 SEAQAEIKALRLSERLREKAVEEL 58 >gb|KHN15454.1| Microtubule-associated protein 70-2 [Glycine soja] Length = 573 Score = 63.2 bits (152), Expect(2) = 5e-14 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 2 DADEFMNLLHGSDPVKVELNRLENEVRDKD 31 Score = 41.6 bits (96), Expect(2) = 5e-14 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 35 SEAQAEIKALRLSERLREKAVEEL 58 >gb|KMZ63923.1| microtubule-associated proteins 70-2 [Zostera marina] Length = 618 Score = 64.3 bits (155), Expect(2) = 7e-14 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEFINLLHGSDPVKVELNRLENEVRDKD Sbjct: 48 DADEFINLLHGSDPVKVELNRLENEVRDKD 77 Score = 40.0 bits (92), Expect(2) = 7e-14 Identities = 19/23 (82%), Positives = 23/23 (100%) Frame = -1 Query: 298 DAQAEIKALRLSERSRERAVEEL 230 ++QAEIKALRLSER+RE+AVEEL Sbjct: 82 ESQAEIKALRLSERAREKAVEEL 104 >ref|XP_009380076.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata subsp. malaccensis] Length = 621 Score = 61.2 bits (147), Expect(2) = 9e-14 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 + DEFINLLHGSDPVKVELNRLENEVRDKD Sbjct: 57 EVDEFINLLHGSDPVKVELNRLENEVRDKD 86 Score = 42.7 bits (99), Expect(2) = 9e-14 Identities = 25/45 (55%), Positives = 34/45 (75%), Gaps = 2/45 (4%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL--GFDKEN*RKYCSESNIHNR 173 S++QAEIKALRLSER+RE+AVEEL +K + + +ES + NR Sbjct: 90 SESQAEIKALRLSERAREKAVEELTEELNKMDEKLKLTESLLENR 134 >ref|XP_010088195.1| hypothetical protein L484_005541 [Morus notabilis] gi|587841738|gb|EXB32335.1| hypothetical protein L484_005541 [Morus notabilis] Length = 637 Score = 63.5 bits (153), Expect(2) = 1e-13 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVKVELNRLENEVRDKD Sbjct: 50 DADEFLNLLHGSDPVKVELNRLENEVRDKD 79 Score = 40.0 bits (92), Expect(2) = 1e-13 Identities = 20/23 (86%), Positives = 22/23 (95%) Frame = -1 Query: 298 DAQAEIKALRLSERSRERAVEEL 230 +AQAEIKALRLSER RE+AVEEL Sbjct: 84 EAQAEIKALRLSERLREKAVEEL 106 >ref|XP_004239261.1| PREDICTED: microtubule-associated protein 70-1 [Solanum lycopersicum] Length = 622 Score = 62.0 bits (149), Expect(2) = 1e-13 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVK+ELNRLENEVRDKD Sbjct: 55 DADEFMNLLHGSDPVKLELNRLENEVRDKD 84 Score = 41.6 bits (96), Expect(2) = 1e-13 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+AQAEIKALRLSER RE+AVEEL Sbjct: 88 SEAQAEIKALRLSERLREKAVEEL 111 >ref|XP_010273713.1| PREDICTED: microtubule-associated protein 70-1-like [Nelumbo nucifera] Length = 642 Score = 64.3 bits (155), Expect(2) = 2e-13 Identities = 30/30 (100%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEFINLLHGSDPVKVELNRLENEVRDKD Sbjct: 69 DADEFINLLHGSDPVKVELNRLENEVRDKD 98 Score = 38.9 bits (89), Expect(2) = 2e-13 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -1 Query: 298 DAQAEIKALRLSERSRERAVEEL 230 +AQAEIKAL+LSER RE+AVEEL Sbjct: 103 EAQAEIKALKLSERLREKAVEEL 125 >ref|XP_009390353.1| PREDICTED: microtubule-associated protein 70-1-like [Musa acuminata subsp. malaccensis] Length = 621 Score = 61.2 bits (147), Expect(2) = 2e-13 Identities = 28/30 (93%), Positives = 29/30 (96%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 D +EFINLLHGSDPVKVELNRLENEVRDKD Sbjct: 57 DVEEFINLLHGSDPVKVELNRLENEVRDKD 86 Score = 42.0 bits (97), Expect(2) = 2e-13 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 S+A AEIKALRLSER+RERAVEEL Sbjct: 90 SEAHAEIKALRLSERARERAVEEL 113 >ref|XP_009417688.1| PREDICTED: microtubule-associated protein 70-2-like [Musa acuminata subsp. malaccensis] Length = 642 Score = 62.8 bits (151), Expect(2) = 2e-13 Identities = 29/30 (96%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 +ADEFINLLHGSDPVKVELNRLENEVRDKD Sbjct: 39 EADEFINLLHGSDPVKVELNRLENEVRDKD 68 Score = 40.0 bits (92), Expect(2) = 2e-13 Identities = 19/23 (82%), Positives = 23/23 (100%) Frame = -1 Query: 298 DAQAEIKALRLSERSRERAVEEL 230 +AQAEIKAL+LSER+RE+AVEEL Sbjct: 73 EAQAEIKALKLSERAREKAVEEL 95 >ref|XP_009777395.1| PREDICTED: microtubule-associated protein 70-2-like [Nicotiana sylvestris] Length = 618 Score = 62.4 bits (150), Expect(2) = 2e-13 Identities = 28/30 (93%), Positives = 30/30 (100%) Frame = -2 Query: 390 DADEFINLLHGSDPVKVELNRLENEVRDKD 301 DADEF+NLLHGSDPVK+ELNRLENEVRDKD Sbjct: 50 DADEFLNLLHGSDPVKLELNRLENEVRDKD 79 Score = 40.4 bits (93), Expect(2) = 2e-13 Identities = 20/24 (83%), Positives = 23/24 (95%) Frame = -1 Query: 301 SDAQAEIKALRLSERSRERAVEEL 230 ++AQAEIKALRLSER RE+AVEEL Sbjct: 83 TEAQAEIKALRLSERLREKAVEEL 106