BLASTX nr result
ID: Papaver29_contig00020922
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00020922 (743 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AIA24415.1| cinnamoyl-CoA reductase 1 [Sinopodophyllum hexand... 44 1e-06 >gb|AIA24415.1| cinnamoyl-CoA reductase 1 [Sinopodophyllum hexandrum] Length = 321 Score = 43.5 bits (101), Expect(2) = 1e-06 Identities = 26/43 (60%), Positives = 29/43 (67%), Gaps = 3/43 (6%) Frame = +3 Query: 114 VIHPGTVMGPIIPPAVNAS--MFIRLT*GNAMTF-SFIMRTLH 233 VI+PGTVMGPIIPPAVNAS M IRL G + F M +H Sbjct: 184 VINPGTVMGPIIPPAVNASMLMLIRLLEGCTEEYKDFYMGPIH 226 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 16/27 (59%), Positives = 19/27 (70%) Frame = +1 Query: 28 RMGQLCYPDSKIMTEKDAWDFANETGL 108 + +L YP SK M EK AWDFA +TGL Sbjct: 154 KQNELWYPLSKTMAEKMAWDFAKDTGL 180