BLASTX nr result
ID: Papaver29_contig00020691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00020691 (480 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containi... 68 3e-09 emb|CBI24106.3| unnamed protein product [Vitis vinifera] 64 6e-08 emb|CBI27495.3| unnamed protein product [Vitis vinifera] 63 1e-07 ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containi... 63 1e-07 emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera] 63 1e-07 ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein... 60 5e-07 ref|XP_012485361.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 ref|XP_012485362.1| PREDICTED: pentatricopeptide repeat-containi... 60 6e-07 gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium r... 60 6e-07 emb|CDP07966.1| unnamed protein product [Coffea canephora] 59 1e-06 gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina] 59 2e-06 ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containi... 58 2e-06 ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 58 2e-06 ref|XP_002521865.1| pentatricopeptide repeat-containing protein,... 58 2e-06 ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Caps... 58 2e-06 dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana] 58 2e-06 ref|XP_002871585.1| pentatricopeptide repeat-containing protein ... 58 2e-06 dbj|BAD95045.1| putative protein [Arabidopsis thaliana] 58 2e-06 ref|NP_196881.2| pentatricopeptide repeat-containing protein [Ar... 58 2e-06 >ref|XP_010270795.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic [Nelumbo nucifera] Length = 636 Score = 67.8 bits (164), Expect = 3e-09 Identities = 36/69 (52%), Positives = 46/69 (66%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINTPNREPNRPVQNIWVR 301 LLQDMK +G GLD++LYRSA+NALRDAGL+ Q K FEESF S NR ++ + + Sbjct: 566 LLQDMKLEGTGLDVKLYRSALNALRDAGLQVQVKWFEESFASTRIKFLTVNRSLKTMMTK 625 Query: 300 KLPVEP*EQ 274 K + EQ Sbjct: 626 KYKLGSFEQ 634 >emb|CBI24106.3| unnamed protein product [Vitis vinifera] Length = 568 Score = 63.5 bits (153), Expect = 6e-08 Identities = 32/58 (55%), Positives = 41/58 (70%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINTPNREPNRPVQNIW 307 LLQDMK +G GLD RLYRSA+NALRDAGL+ QA+ +ESFD+ + Q++W Sbjct: 485 LLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDTKVYIFKTAAESTQSLW 542 >emb|CBI27495.3| unnamed protein product [Vitis vinifera] Length = 552 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDS 355 LLQDMK +G GLD RLYRSA+NALRDAGL+ QA+ +ESFD+ Sbjct: 499 LLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDT 540 >ref|XP_002269531.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic-like [Vitis vinifera] Length = 603 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDS 355 LLQDMK +G GLD RLYRSA+NALRDAGL+ QA+ +ESFD+ Sbjct: 561 LLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDT 602 >ref|XP_002273494.2| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic-like [Vitis vinifera] Length = 609 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDS 355 LLQDMK +G GLD RLYRSA+NALRDAGL+ QA+ +ESFD+ Sbjct: 562 LLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDT 603 >emb|CAN71209.1| hypothetical protein VITISV_030057 [Vitis vinifera] Length = 109 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/42 (71%), Positives = 36/42 (85%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDS 355 LLQDMK +G GLD RLYRSA+NALRDAGL+ QA+ +ESFD+ Sbjct: 67 LLQDMKTEGTGLDERLYRSALNALRDAGLQMQARWLQESFDT 108 >ref|XP_007015128.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] gi|508785491|gb|EOY32747.1| Pentatricopeptide repeat superfamily protein, putative [Theobroma cacao] Length = 608 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/42 (71%), Positives = 35/42 (83%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDS 355 LLQDMKA+G LD RLY SAMNALRDAGLE QAK +++FD+ Sbjct: 566 LLQDMKAEGTQLDGRLYHSAMNALRDAGLETQAKWLQKNFDA 607 >ref|XP_012485361.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic isoform X1 [Gossypium raimondii] Length = 617 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSI 352 LLQDMKA+G LD RLY SAMNALRDAGLE+Q K +++FD++ Sbjct: 569 LLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNFDAM 611 >ref|XP_012485362.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic isoform X2 [Gossypium raimondii] gi|763768528|gb|KJB35743.1| hypothetical protein B456_006G126500 [Gossypium raimondii] Length = 585 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSI 352 LLQDMKA+G LD RLY SAMNALRDAGLE+Q K +++FD++ Sbjct: 537 LLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNFDAM 579 >gb|KJB35742.1| hypothetical protein B456_006G126500 [Gossypium raimondii] Length = 441 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/43 (67%), Positives = 36/43 (83%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSI 352 LLQDMKA+G LD RLY SAMNALRDAGLE+Q K +++FD++ Sbjct: 393 LLQDMKAEGTELDGRLYHSAMNALRDAGLENQVKWLQKNFDAM 435 >emb|CDP07966.1| unnamed protein product [Coffea canephora] Length = 615 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESF 361 LLQDMK +G LD+RLYRSA+NALRDAGL QAK +ESF Sbjct: 573 LLQDMKTEGTKLDVRLYRSALNALRDAGLHVQAKWLQESF 612 >gb|KFK25604.1| hypothetical protein AALP_AA8G136200 [Arabis alpina] Length = 606 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMKA+ LD+RLY SA+NALRDAGL Q + +ESFDS T Sbjct: 545 LLQDMKAERTKLDVRLYTSALNALRDAGLNSQIRWLQESFDSAQT 589 >ref|XP_010492155.1| PREDICTED: pentatricopeptide repeat-containing protein At5g13770, chloroplastic-like [Camelina sativa] Length = 614 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 547 LLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQT 591 >ref|XP_010453475.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At5g13770, chloroplastic-like [Camelina sativa] Length = 602 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 547 LLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQT 591 >ref|XP_002521865.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223538903|gb|EEF40501.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 449 Score = 58.2 bits (139), Expect = 2e-06 Identities = 29/43 (67%), Positives = 35/43 (81%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSI 352 LLQD+K +G LD RLYRSA NALRDAGL+ QAK +ESF++I Sbjct: 407 LLQDIKTEGTQLDGRLYRSAFNALRDAGLQMQAKWMQESFEAI 449 >ref|XP_006289562.1| hypothetical protein CARUB_v10003108mg [Capsella rubella] gi|482558268|gb|EOA22460.1| hypothetical protein CARUB_v10003108mg [Capsella rubella] Length = 612 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 551 LLQDMKVEGTRLDARLYTSALNALRDAGLNSQIRWLQESFDAAQT 595 >dbj|BAB10598.1| unnamed protein product [Arabidopsis thaliana] Length = 563 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 504 LLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAAQT 548 >ref|XP_002871585.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297317422|gb|EFH47844.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 550 LLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAAQT 594 >dbj|BAD95045.1| putative protein [Arabidopsis thaliana] Length = 126 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 67 LLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAAQT 111 >ref|NP_196881.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|75115356|sp|Q66GP4.1|PP379_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At5g13770, chloroplastic; Flags: Precursor gi|51536486|gb|AAU05481.1| At5g13770 [Arabidopsis thaliana] gi|53850491|gb|AAU95422.1| At5g13770 [Arabidopsis thaliana] gi|332004556|gb|AED91939.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 609 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/45 (62%), Positives = 33/45 (73%) Frame = -1 Query: 480 LLQDMKADGAGLDLRLYRSAMNALRDAGLEDQAKRFEESFDSINT 346 LLQDMK +G LD RLY SA+NALRDAGL Q + +ESFD+ T Sbjct: 550 LLQDMKVEGTRLDARLYSSALNALRDAGLNSQIRWLQESFDAAQT 594