BLASTX nr result
ID: Papaver29_contig00019439
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00019439 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value dbj|BAS88454.1| Os04g0298200 [Oryza sativa Japonica Group] 104 2e-20 emb|CAD40428.3| OSJNBa0035B13.1 [Oryza sativa Japonica Group] 104 2e-20 gb|EEE60698.1| hypothetical protein OsJ_14188 [Oryza sativa Japo... 104 2e-20 gb|EEC76976.1| hypothetical protein OsI_15280 [Oryza sativa Indi... 104 2e-20 ref|XP_006653252.1| PREDICTED: metal tolerance protein C4-like [... 104 2e-20 ref|NP_001141558.1| uncharacterized LOC100273674 [Zea mays] gi|1... 102 9e-20 tpg|DAA38301.1| TPA: hypothetical protein ZEAMMB73_608862 [Zea m... 102 9e-20 ref|XP_008799464.1| PREDICTED: metal tolerance protein C4 isofor... 102 1e-19 ref|XP_008799463.1| PREDICTED: metal tolerance protein C4 isofor... 102 1e-19 ref|XP_004975228.1| PREDICTED: metal tolerance protein C4 [Setar... 102 1e-19 ref|XP_002447611.1| hypothetical protein SORBIDRAFT_06g007330 [S... 102 1e-19 gb|KJB66471.1| hypothetical protein B456_010G141000 [Gossypium r... 101 2e-19 ref|XP_011046526.1| PREDICTED: metal tolerance protein C4 [Popul... 101 2e-19 ref|XP_010929327.1| PREDICTED: metal tolerance protein C4-like i... 101 2e-19 ref|XP_010929326.1| PREDICTED: metal tolerance protein C4-like i... 101 2e-19 ref|XP_009390444.1| PREDICTED: metal tolerance protein C4 [Musa ... 101 2e-19 ref|XP_009345995.1| PREDICTED: metal tolerance protein C4-like [... 101 2e-19 ref|XP_008342418.1| PREDICTED: metal tolerance protein C4-like [... 101 2e-19 ref|XP_002315378.2| hypothetical protein POPTR_0010s25780g [Popu... 101 2e-19 gb|KQJ82050.1| hypothetical protein BRADI_5g05190 [Brachypodium ... 100 3e-19 >dbj|BAS88454.1| Os04g0298200 [Oryza sativa Japonica Group] Length = 472 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRGEWAKQ Sbjct: 363 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ 411 >emb|CAD40428.3| OSJNBa0035B13.1 [Oryza sativa Japonica Group] Length = 334 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRGEWAKQ Sbjct: 225 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ 273 >gb|EEE60698.1| hypothetical protein OsJ_14188 [Oryza sativa Japonica Group] Length = 372 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRGEWAKQ Sbjct: 263 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ 311 >gb|EEC76976.1| hypothetical protein OsI_15280 [Oryza sativa Indica Group] Length = 472 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRGEWAKQ Sbjct: 363 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ 411 >ref|XP_006653252.1| PREDICTED: metal tolerance protein C4-like [Oryza brachyantha] Length = 401 Score = 104 bits (260), Expect = 2e-20 Identities = 48/49 (97%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRGEWAKQ Sbjct: 292 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGEWAKQ 340 >ref|NP_001141558.1| uncharacterized LOC100273674 [Zea mays] gi|194705064|gb|ACF86616.1| unknown [Zea mays] Length = 125 Score = 102 bits (255), Expect = 9e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRG WAKQ Sbjct: 11 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGSWAKQ 59 >tpg|DAA38301.1| TPA: hypothetical protein ZEAMMB73_608862 [Zea mays] Length = 474 Score = 102 bits (255), Expect = 9e-20 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRG WAKQ Sbjct: 360 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGSWAKQ 408 >ref|XP_008799464.1| PREDICTED: metal tolerance protein C4 isoform X2 [Phoenix dactylifera] Length = 313 Score = 102 bits (254), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFK+EIDFNGV+VVQNYLERTGRGEW+KQ Sbjct: 204 DPVVDALYDCKSEVIGPGFFRFKSEIDFNGVMVVQNYLERTGRGEWSKQ 252 >ref|XP_008799463.1| PREDICTED: metal tolerance protein C4 isoform X1 [Phoenix dactylifera] Length = 472 Score = 102 bits (254), Expect = 1e-19 Identities = 46/49 (93%), Positives = 49/49 (100%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFK+EIDFNGV+VVQNYLERTGRGEW+KQ Sbjct: 363 DPVVDALYDCKSEVIGPGFFRFKSEIDFNGVMVVQNYLERTGRGEWSKQ 411 >ref|XP_004975228.1| PREDICTED: metal tolerance protein C4 [Setaria italica] gi|944232285|gb|KQK96647.1| hypothetical protein SETIT_009994mg [Setaria italica] Length = 478 Score = 102 bits (254), Expect = 1e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRG WAKQ Sbjct: 364 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGTWAKQ 412 >ref|XP_002447611.1| hypothetical protein SORBIDRAFT_06g007330 [Sorghum bicolor] gi|241938794|gb|EES11939.1| hypothetical protein SORBIDRAFT_06g007330 [Sorghum bicolor] Length = 250 Score = 102 bits (254), Expect = 1e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRG WAKQ Sbjct: 139 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGTWAKQ 187 >gb|KJB66471.1| hypothetical protein B456_010G141000 [Gossypium raimondii] Length = 414 Score = 101 bits (252), Expect = 2e-19 Identities = 47/52 (90%), Positives = 49/52 (94%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQASI 361 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYL RTGR EWA+Q +I Sbjct: 341 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLNRTGREEWARQVNI 392 >ref|XP_011046526.1| PREDICTED: metal tolerance protein C4 [Populus euphratica] Length = 459 Score = 101 bits (252), Expect = 2e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYL RTGRGEW++Q Sbjct: 350 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLSRTGRGEWSRQ 398 >ref|XP_010929327.1| PREDICTED: metal tolerance protein C4-like isoform X2 [Elaeis guineensis] Length = 327 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGV+VVQNYLERTGR EWAKQ Sbjct: 218 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVMVVQNYLERTGREEWAKQ 266 >ref|XP_010929326.1| PREDICTED: metal tolerance protein C4-like isoform X1 [Elaeis guineensis] Length = 468 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGV+VVQNYLERTGR EWAKQ Sbjct: 359 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVMVVQNYLERTGREEWAKQ 407 >ref|XP_009390444.1| PREDICTED: metal tolerance protein C4 [Musa acuminata subsp. malaccensis] Length = 469 Score = 101 bits (252), Expect = 2e-19 Identities = 47/49 (95%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGR EWAKQ Sbjct: 348 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGREEWAKQ 396 >ref|XP_009345995.1| PREDICTED: metal tolerance protein C4-like [Pyrus x bretschneideri] Length = 453 Score = 101 bits (252), Expect = 2e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVD+LYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYL RTGRGEWA+Q Sbjct: 344 DPVVDSLYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLHRTGRGEWARQ 392 >ref|XP_008342418.1| PREDICTED: metal tolerance protein C4-like [Malus domestica] Length = 456 Score = 101 bits (252), Expect = 2e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVD+LYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYL RTGRGEWA+Q Sbjct: 347 DPVVDSLYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLHRTGRGEWARQ 395 >ref|XP_002315378.2| hypothetical protein POPTR_0010s25780g [Populus trichocarpa] gi|550330613|gb|EEF01549.2| hypothetical protein POPTR_0010s25780g [Populus trichocarpa] Length = 459 Score = 101 bits (252), Expect = 2e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYL RTGRGEW++Q Sbjct: 350 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLSRTGRGEWSRQ 398 >gb|KQJ82050.1| hypothetical protein BRADI_5g05190 [Brachypodium distachyon] Length = 374 Score = 100 bits (250), Expect = 3e-19 Identities = 46/49 (93%), Positives = 48/49 (97%) Frame = -2 Query: 516 DPVVDALYDCKSEVIGPGFFRFKAEIDFNGVVVVQNYLERTGRGEWAKQ 370 DPVVD+LYDCKSEVIGPGFFRFKAEIDFNGVV+VQNYLERTGRG WAKQ Sbjct: 265 DPVVDSLYDCKSEVIGPGFFRFKAEIDFNGVVLVQNYLERTGRGVWAKQ 313