BLASTX nr result
ID: Papaver29_contig00019108
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00019108 (539 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003623642.2| phototropic-responsive NPH3 family protein [... 75 2e-11 gb|KOM28142.1| hypothetical protein LR48_Vigan503s001700 [Vigna ... 72 1e-10 ref|XP_007140048.1| hypothetical protein PHAVU_008G080100g [Phas... 72 1e-10 ref|XP_007208710.1| hypothetical protein PRUPE_ppa003095mg [Prun... 72 1e-10 ref|XP_012091015.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-10 ref|XP_014498381.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma... 72 2e-10 ref|XP_006602729.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-10 ref|XP_006602728.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-10 ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein... 71 3e-10 ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein... 71 3e-10 gb|KNA23447.1| hypothetical protein SOVF_024540 [Spinacia oleracea] 71 4e-10 gb|KFK24693.1| hypothetical protein AALP_AA8G012500 [Arabis alpina] 70 5e-10 gb|KRH40662.1| hypothetical protein GLYMA_09G272500 [Glycine max... 70 6e-10 gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] 70 6e-10 ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein... 70 6e-10 ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein... 70 6e-10 ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein... 70 6e-10 ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein... 70 6e-10 gb|AAG51355.1|AC012562_16 hypothetical protein; 15198-13181 [Ara... 70 8e-10 ref|XP_010683440.1| PREDICTED: BTB/POZ domain-containing protein... 70 8e-10 >ref|XP_003623642.2| phototropic-responsive NPH3 family protein [Medicago truncatula] gi|657378586|gb|AES79860.2| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 641 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/50 (74%), Positives = 45/50 (90%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+A+LAEIAP+PCL+L+KF +IEIL D ARVIDDGL+RAI+I LK Sbjct: 389 VGQLIDAFLAEIAPDPCLSLQKFIALIEILPDYARVIDDGLYRAIDIYLK 438 >gb|KOM28142.1| hypothetical protein LR48_Vigan503s001700 [Vigna angularis] Length = 608 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = +3 Query: 351 CKVSMGMCYKAR*VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEI 530 C G K VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I Sbjct: 375 CSAGHGSLLK---VGQLIDAYLAEIAPDPYLSLQKFVALIEILPDYARVIDDGLYRAVDI 431 Query: 531 SLK 539 LK Sbjct: 432 YLK 434 >ref|XP_007140048.1| hypothetical protein PHAVU_008G080100g [Phaseolus vulgaris] gi|561013181|gb|ESW12042.1| hypothetical protein PHAVU_008G080100g [Phaseolus vulgaris] Length = 593 Score = 72.4 bits (176), Expect = 1e-10 Identities = 39/63 (61%), Positives = 47/63 (74%) Frame = +3 Query: 351 CKVSMGMCYKAR*VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEI 530 C G K VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I Sbjct: 375 CSAGHGSLLK---VGQLIDAYLAEIAPDPYLSLQKFVALIEILPDYARVIDDGLYRAVDI 431 Query: 531 SLK 539 LK Sbjct: 432 YLK 434 >ref|XP_007208710.1| hypothetical protein PRUPE_ppa003095mg [Prunus persica] gi|462404352|gb|EMJ09909.1| hypothetical protein PRUPE_ppa003095mg [Prunus persica] Length = 605 Score = 72.4 bits (176), Expect = 1e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+ YLAEIAP+PCL+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 382 VGRLIDTYLAEIAPDPCLSLQKFIAMIEILPDYARVIDDGLYRAVDIYLK 431 >ref|XP_012091015.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Jatropha curcas] gi|643705228|gb|KDP21845.1| hypothetical protein JCGZ_00632 [Jatropha curcas] Length = 606 Score = 72.0 bits (175), Expect = 2e-10 Identities = 36/50 (72%), Positives = 45/50 (90%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+AYLAEIAP+P L+L+KFT ++EIL D ARVIDDGL+RAI+I LK Sbjct: 383 VGRLIDAYLAEIAPDPYLSLQKFTAMVEILPDYARVIDDGLYRAIDIYLK 432 >ref|XP_014498381.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein At3g08570 [Vigna radiata var. radiata] Length = 593 Score = 71.6 bits (174), Expect = 2e-10 Identities = 38/63 (60%), Positives = 47/63 (74%) Frame = +3 Query: 351 CKVSMGMCYKAR*VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEI 530 C G K VGQL++AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I Sbjct: 375 CSAGHGSLLK---VGQLLDAYLAEIAPDPYLSLQKFVALIEILPDYARVIDDGLYRAVDI 431 Query: 531 SLK 539 LK Sbjct: 432 YLK 434 >ref|XP_006602729.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] gi|947050968|gb|KRH00497.1| hypothetical protein GLYMA_18G216600 [Glycine max] Length = 598 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGLYRAVDIYLK 434 >ref|XP_006602728.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] gi|734420099|gb|KHN40605.1| BTB/POZ domain-containing protein [Glycine soja] gi|947050969|gb|KRH00498.1| hypothetical protein GLYMA_18G216600 [Glycine max] Length = 608 Score = 71.6 bits (174), Expect = 2e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDGL+RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGLYRAVDIYLK 434 >ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X2 [Nelumbo nucifera] Length = 600 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+AYLAEIAP+P LNL++F IIEIL D ARV+DDGL+RA++I LK Sbjct: 377 VGRLIDAYLAEIAPDPYLNLQRFIAIIEILPDYARVVDDGLYRAVDIYLK 426 >ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X1 [Nelumbo nucifera] Length = 609 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+AYLAEIAP+P LNL++F IIEIL D ARV+DDGL+RA++I LK Sbjct: 386 VGRLIDAYLAEIAPDPYLNLQRFIAIIEILPDYARVVDDGLYRAVDIYLK 435 >gb|KNA23447.1| hypothetical protein SOVF_024540 [Spinacia oleracea] Length = 615 Score = 70.9 bits (172), Expect = 4e-10 Identities = 36/50 (72%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+AYLAEIAP+P L+L+KFT IIE L D ARVIDDGL+RA++I LK Sbjct: 397 VGRLIDAYLAEIAPDPYLSLQKFTAIIEALPDYARVIDDGLYRALDIYLK 446 >gb|KFK24693.1| hypothetical protein AALP_AA8G012500 [Arabis alpina] Length = 610 Score = 70.5 bits (171), Expect = 5e-10 Identities = 34/50 (68%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG++I+AYLAEIAP+PCL+L KFT +I IL D ARV+DDGL+RAI++ LK Sbjct: 383 VGRIIDAYLAEIAPDPCLSLHKFTALIGILPDYARVMDDGLYRAIDMFLK 432 >gb|KRH40662.1| hypothetical protein GLYMA_09G272500 [Glycine max] gi|947091998|gb|KRH40663.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 538 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 325 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 374 >gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] Length = 608 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 434 >ref|XP_006587906.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X4 [Glycine max] gi|571479597|ref|XP_006587907.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X5 [Glycine max] Length = 548 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 325 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 374 >ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X3 [Glycine max] Length = 597 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 374 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 423 >ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] gi|947091995|gb|KRH40660.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 598 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 434 >ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] gi|947091996|gb|KRH40661.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 608 Score = 70.1 bits (170), Expect = 6e-10 Identities = 35/50 (70%), Positives = 43/50 (86%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VGQLI+AYLAEIAP+P L+L+KF +IEIL D ARVIDDG +RA++I LK Sbjct: 385 VGQLIDAYLAEIAPDPYLSLQKFIALIEILPDYARVIDDGFYRAVDIYLK 434 >gb|AAG51355.1|AC012562_16 hypothetical protein; 15198-13181 [Arabidopsis thaliana] Length = 612 Score = 69.7 bits (169), Expect = 8e-10 Identities = 33/50 (66%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG++++AYLAEIAP+PCL+L KF +IEIL D ARV+DDGL+RAI++ LK Sbjct: 385 VGRIMDAYLAEIAPDPCLSLHKFMALIEILPDYARVMDDGLYRAIDMFLK 434 >ref|XP_010683440.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 [Beta vulgaris subsp. vulgaris] gi|870854743|gb|KMT06491.1| hypothetical protein BVRB_7g156670 [Beta vulgaris subsp. vulgaris] Length = 617 Score = 69.7 bits (169), Expect = 8e-10 Identities = 35/50 (70%), Positives = 44/50 (88%) Frame = +3 Query: 390 VGQLIEAYLAEIAPNPCLNLKKFTNIIEILSD*ARVIDDGLHRAIEISLK 539 VG+LI+AYLAEIAP+P L+L+KFT I+E L D ARVIDDGL+RA++I LK Sbjct: 399 VGRLIDAYLAEIAPDPYLSLQKFTAIMETLPDYARVIDDGLYRALDIYLK 448