BLASTX nr result
ID: Papaver29_contig00019106
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00019106 (494 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK38267.1| hypothetical protein AALP_AA3G091600 [Arabis alpina] 77 9e-13 ref|XP_006429637.1| hypothetical protein CICLE_v10011315mg [Citr... 76 3e-12 ref|XP_006481239.1| PREDICTED: BTB/POZ domain-containing protein... 76 3e-12 gb|KDO64171.1| hypothetical protein CISIN_1g035818mg, partial [C... 76 3e-12 ref|XP_010922793.1| PREDICTED: BTB/POZ domain-containing protein... 73 8e-12 ref|XP_008803011.1| PREDICTED: BTB/POZ domain-containing protein... 73 8e-12 ref|XP_010931396.1| PREDICTED: BTB/POZ domain-containing protein... 73 1e-11 ref|XP_010931398.1| PREDICTED: BTB/POZ domain-containing protein... 73 1e-11 ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein... 72 1e-11 ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein... 72 1e-11 ref|XP_003623642.2| phototropic-responsive NPH3 family protein [... 72 2e-11 ref|XP_009605134.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-11 ref|XP_002882578.1| hypothetical protein ARALYDRAFT_478168 [Arab... 73 2e-11 ref|XP_009605138.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-11 ref|NP_187478.1| phototropic-responsive NPH3 family protein [Ara... 73 2e-11 ref|XP_010486408.1| PREDICTED: putative BTB/POZ domain-containin... 73 2e-11 gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] 72 2e-11 ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-11 ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-11 ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein... 72 2e-11 >gb|KFK38267.1| hypothetical protein AALP_AA3G091600 [Arabis alpina] Length = 589 Score = 77.4 bits (189), Expect(2) = 9e-13 Identities = 36/46 (78%), Positives = 40/46 (86%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTE ESKKLCKYIDC+KLSQE SNHVA NDRLPVQ+ VR+L Sbjct: 420 KAHPLLTEEESKKLCKYIDCKKLSQEASNHVAQNDRLPVQMVVRVL 465 Score = 22.3 bits (46), Expect(2) = 9e-13 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LY EQLRLKKA Sbjct: 465 LYSEQLRLKKA 475 >ref|XP_006429637.1| hypothetical protein CICLE_v10011315mg [Citrus clementina] gi|568855286|ref|XP_006481238.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Citrus sinensis] gi|557531694|gb|ESR42877.1| hypothetical protein CICLE_v10011315mg [Citrus clementina] Length = 611 Score = 75.9 bits (185), Expect(2) = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTE+E KKLCK+IDCQKLSQE SNH A NDRLPVQ+AVR+L Sbjct: 438 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 483 Score = 21.9 bits (45), Expect(2) = 3e-12 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRL+ A Sbjct: 483 LYFEQLRLQNA 493 >ref|XP_006481239.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Citrus sinensis] Length = 591 Score = 75.9 bits (185), Expect(2) = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTE+E KKLCK+IDCQKLSQE SNH A NDRLPVQ+AVR+L Sbjct: 418 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 463 Score = 21.9 bits (45), Expect(2) = 3e-12 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRL+ A Sbjct: 463 LYFEQLRLQNA 473 >gb|KDO64171.1| hypothetical protein CISIN_1g035818mg, partial [Citrus sinensis] Length = 568 Score = 75.9 bits (185), Expect(2) = 3e-12 Identities = 35/46 (76%), Positives = 40/46 (86%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTE+E KKLCK+IDCQKLSQE SNH A NDRLPVQ+AVR+L Sbjct: 395 KAHPMLTEHECKKLCKFIDCQKLSQEASNHAAQNDRLPVQMAVRVL 440 Score = 21.9 bits (45), Expect(2) = 3e-12 Identities = 9/11 (81%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRL+ A Sbjct: 440 LYFEQLRLQNA 450 >ref|XP_010922793.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Elaeis guineensis] Length = 609 Score = 73.2 bits (178), Expect(2) = 8e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH +LTE+E KKLCK IDCQKLSQE SNH A NDRLPVQ+ +R+L Sbjct: 433 KAHPSLTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVIRVL 478 Score = 23.5 bits (49), Expect(2) = 8e-12 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_008803011.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like [Phoenix dactylifera] Length = 609 Score = 73.2 bits (178), Expect(2) = 8e-12 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH +LTE+E KKLCK IDCQKLSQE SNH A NDRLPVQ+ +R+L Sbjct: 433 KAHPSLTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVIRVL 478 Score = 23.5 bits (49), Expect(2) = 8e-12 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_010931396.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Elaeis guineensis] Length = 611 Score = 72.8 bits (177), Expect(2) = 1e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ++TE+E KKLCK IDCQKLSQE SNH A NDRLPVQ+ VR+L Sbjct: 433 KAHPSMTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVVRVL 478 Score = 23.5 bits (49), Expect(2) = 1e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 478 LYFEQLRLKSA 488 >ref|XP_010931398.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Elaeis guineensis] Length = 548 Score = 72.8 bits (177), Expect(2) = 1e-11 Identities = 33/46 (71%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ++TE+E KKLCK IDCQKLSQE SNH A NDRLPVQ+ VR+L Sbjct: 370 KAHPSMTESECKKLCKLIDCQKLSQEASNHAAQNDRLPVQMVVRVL 415 Score = 23.5 bits (49), Expect(2) = 1e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 415 LYFEQLRLKSA 425 >ref|XP_010244571.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X1 [Nelumbo nucifera] Length = 609 Score = 72.4 bits (176), Expect(2) = 1e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTENE K LCK+IDCQKLSQE NH A NDRLPVQ+ VR+L Sbjct: 435 KAHPMLTENECKNLCKFIDCQKLSQEACNHAAQNDRLPVQMVVRVL 480 Score = 23.5 bits (49), Expect(2) = 1e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 480 LYFEQLRLKNA 490 >ref|XP_010244572.1| PREDICTED: BTB/POZ domain-containing protein At3g08570 isoform X2 [Nelumbo nucifera] Length = 600 Score = 72.4 bits (176), Expect(2) = 1e-11 Identities = 33/46 (71%), Positives = 37/46 (80%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTENE K LCK+IDCQKLSQE NH A NDRLPVQ+ VR+L Sbjct: 426 KAHPMLTENECKNLCKFIDCQKLSQEACNHAAQNDRLPVQMVVRVL 471 Score = 23.5 bits (49), Expect(2) = 1e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 471 LYFEQLRLKNA 481 >ref|XP_003623642.2| phototropic-responsive NPH3 family protein [Medicago truncatula] gi|657378586|gb|AES79860.2| phototropic-responsive NPH3 family protein [Medicago truncatula] Length = 641 Score = 72.0 bits (175), Expect(2) = 2e-11 Identities = 32/46 (69%), Positives = 38/46 (82%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ALTE E KKLCK+IDCQKLSQE NH A NDRLP+Q+ V++L Sbjct: 438 KAHTALTEQECKKLCKFIDCQKLSQEACNHAAQNDRLPLQMVVQVL 483 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 483 LYFEQLRLKNA 493 >ref|XP_009605134.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Nicotiana tomentosiformis] Length = 624 Score = 72.0 bits (175), Expect(2) = 2e-11 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH L+E+E+KKLCK+IDCQKLSQE NH A NDRLPVQ+ VR+L Sbjct: 450 KAHPTLSEHEAKKLCKFIDCQKLSQEACNHAARNDRLPVQMTVRVL 495 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 495 LYFEQLRLKNA 505 >ref|XP_002882578.1| hypothetical protein ARALYDRAFT_478168 [Arabidopsis lyrata subsp. lyrata] gi|297328418|gb|EFH58837.1| hypothetical protein ARALYDRAFT_478168 [Arabidopsis lyrata subsp. lyrata] Length = 606 Score = 73.2 bits (178), Expect(2) = 2e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRILST 344 +AH LTE E KKLCK+IDC+KLSQE SNHVA NDRLPV + VR+L T Sbjct: 414 KAHPLLTEEECKKLCKFIDCKKLSQEASNHVAQNDRLPVHMVVRVLYT 461 Score = 22.3 bits (46), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LY EQLRLKKA Sbjct: 459 LYTEQLRLKKA 469 >ref|XP_009605138.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] gi|697103211|ref|XP_009605144.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] gi|697103213|ref|XP_009605152.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Nicotiana tomentosiformis] Length = 592 Score = 72.0 bits (175), Expect(2) = 2e-11 Identities = 32/46 (69%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH L+E+E+KKLCK+IDCQKLSQE NH A NDRLPVQ+ VR+L Sbjct: 418 KAHPTLSEHEAKKLCKFIDCQKLSQEACNHAARNDRLPVQMTVRVL 463 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 463 LYFEQLRLKNA 473 >ref|NP_187478.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] gi|75262254|sp|Q9C9Z0.1|Y3866_ARATH RecName: Full=Putative BTB/POZ domain-containing protein At3g08660 gi|12322729|gb|AAG51353.1|AC012562_14 putative non-phototropic hypocotyl; 42053-44089 [Arabidopsis thaliana] gi|332641139|gb|AEE74660.1| phototropic-responsive NPH3 family protein [Arabidopsis thaliana] Length = 582 Score = 73.2 bits (178), Expect(2) = 2e-11 Identities = 34/48 (70%), Positives = 39/48 (81%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRILST 344 +AH LTE E KKLC +IDC+KLSQE SNHVA NDRLPVQ+ VR+L T Sbjct: 415 KAHPLLTEEERKKLCNFIDCKKLSQEASNHVAQNDRLPVQMVVRVLYT 462 Score = 22.3 bits (46), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LY EQLRLKKA Sbjct: 460 LYTEQLRLKKA 470 >ref|XP_010486408.1| PREDICTED: putative BTB/POZ domain-containing protein At3g08660 [Camelina sativa] Length = 581 Score = 73.2 bits (178), Expect(2) = 2e-11 Identities = 34/46 (73%), Positives = 39/46 (84%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH LTE ESKKLCK+IDC KLS+E SNHVA NDRLPVQ+ VR+L Sbjct: 412 KAHPLLTEVESKKLCKFIDCNKLSEEASNHVAQNDRLPVQMVVRVL 457 Score = 22.3 bits (46), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LY EQLRLKKA Sbjct: 457 LYSEQLRLKKA 467 >gb|KHN29482.1| BTB/POZ domain-containing protein [Glycine soja] Length = 608 Score = 71.6 bits (174), Expect(2) = 2e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ALTE E KKLCK IDCQKLSQE SNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587903.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X1 [Glycine max] gi|947091996|gb|KRH40661.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 608 Score = 71.6 bits (174), Expect(2) = 2e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ALTE E KKLCK IDCQKLSQE SNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587904.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X2 [Glycine max] gi|947091995|gb|KRH40660.1| hypothetical protein GLYMA_09G272500 [Glycine max] Length = 598 Score = 71.6 bits (174), Expect(2) = 2e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ALTE E KKLCK IDCQKLSQE SNH A NDRLP+Q+ V++L Sbjct: 434 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 479 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 479 LYFEQLRLKNA 489 >ref|XP_006587905.1| PREDICTED: BTB/POZ domain-containing protein At3g08570-like isoform X3 [Glycine max] Length = 597 Score = 71.6 bits (174), Expect(2) = 2e-11 Identities = 33/46 (71%), Positives = 38/46 (82%) Frame = -2 Query: 487 QAHLALTENESKKLCKYIDCQKLSQEISNHVAHNDRLPVQVAVRIL 350 +AH ALTE E KKLCK IDCQKLSQE SNH A NDRLP+Q+ V++L Sbjct: 423 KAHPALTEQECKKLCKLIDCQKLSQEASNHAAQNDRLPLQMVVQVL 468 Score = 23.5 bits (49), Expect(2) = 2e-11 Identities = 10/11 (90%), Positives = 10/11 (90%) Frame = -1 Query: 350 LYFEQLRLKKA 318 LYFEQLRLK A Sbjct: 468 LYFEQLRLKNA 478