BLASTX nr result
ID: Papaver29_contig00018411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00018411 (517 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG26721.1| RNA-binding Musashi Rbp6 [Gossypium arboreum] 59 2e-06 ref|XP_006356840.1| PREDICTED: RNA-binding protein 1-like [Solan... 57 4e-06 ref|XP_009610224.1| PREDICTED: RNA-binding protein 1 [Nicotiana ... 56 9e-06 >gb|KHG26721.1| RNA-binding Musashi Rbp6 [Gossypium arboreum] Length = 393 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/43 (69%), Positives = 34/43 (79%) Frame = -1 Query: 517 SEEAVENVMQKRFHELYGKAVEVKRTVFKDGSNNGQNGGYHMR 389 SEEAVENVMQK FHEL + VEVKR V K+G NNG N GY+M+ Sbjct: 169 SEEAVENVMQKSFHELSNRLVEVKRAVPKEG-NNGGNNGYNMK 210 >ref|XP_006356840.1| PREDICTED: RNA-binding protein 1-like [Solanum tuberosum] Length = 344 Score = 57.4 bits (137), Expect = 4e-06 Identities = 29/43 (67%), Positives = 33/43 (76%) Frame = -1 Query: 517 SEEAVENVMQKRFHELYGKAVEVKRTVFKDGSNNGQNGGYHMR 389 SE+AVE VMQ+ FHEL GK VEVK+ + KDGSNN N GYH R Sbjct: 165 SEDAVEEVMQESFHELSGKFVEVKKAIPKDGSNNSGN-GYHSR 206 >ref|XP_009610224.1| PREDICTED: RNA-binding protein 1 [Nicotiana tomentosiformis] Length = 352 Score = 56.2 bits (134), Expect = 9e-06 Identities = 28/43 (65%), Positives = 33/43 (76%) Frame = -1 Query: 517 SEEAVENVMQKRFHELYGKAVEVKRTVFKDGSNNGQNGGYHMR 389 SE+AVE VMQK FHEL GK VEVKR + KD ++N N GYH+R Sbjct: 172 SEDAVEEVMQKNFHELSGKLVEVKRAIPKDENSNSSN-GYHVR 213