BLASTX nr result
ID: Papaver29_contig00018403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00018403 (1119 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012455410.1| PREDICTED: boron transporter 4-like isoform ... 60 3e-06 ref|XP_012455411.1| PREDICTED: probable boron transporter 7 isof... 60 3e-06 ref|XP_002324278.1| hypothetical protein POPTR_0018s01350g [Popu... 60 3e-06 ref|XP_007013334.1| HCO3- transporter family [Theobroma cacao] g... 60 3e-06 ref|XP_007226316.1| hypothetical protein PRUPE_ppa021289mg, part... 60 3e-06 ref|XP_009389936.1| PREDICTED: boron transporter 4-like isoform ... 60 3e-06 ref|XP_009389934.1| PREDICTED: boron transporter 4-like isoform ... 60 3e-06 ref|XP_009389933.1| PREDICTED: boron transporter 4-like isoform ... 60 3e-06 ref|XP_009334783.1| PREDICTED: probable boron transporter 6 isof... 60 3e-06 ref|XP_009334782.1| PREDICTED: probable boron transporter 6 isof... 60 3e-06 ref|XP_008394033.1| PREDICTED: probable boron transporter 6 isof... 60 3e-06 ref|XP_008394032.1| PREDICTED: probable boron transporter 6 isof... 60 3e-06 ref|XP_008394031.1| PREDICTED: probable boron transporter 6 isof... 60 3e-06 ref|XP_014503344.1| PREDICTED: LOW QUALITY PROTEIN: probable bor... 60 4e-06 gb|KOM25773.1| hypothetical protein LR48_Vigan187s001300 [Vigna ... 60 4e-06 ref|XP_012447513.1| PREDICTED: boron transporter 4 isoform X1 [G... 60 4e-06 ref|XP_012447515.1| PREDICTED: boron transporter 4 isoform X2 [G... 60 4e-06 ref|XP_010914933.1| PREDICTED: boron transporter 4-like [Elaeis ... 60 4e-06 ref|XP_008792146.1| PREDICTED: boron transporter 4-like [Phoenix... 60 4e-06 gb|ABR18319.1| unknown [Picea sitchensis] 60 4e-06 >ref|XP_012455410.1| PREDICTED: boron transporter 4-like isoform X1 [Gossypium raimondii] Length = 674 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_012455411.1| PREDICTED: probable boron transporter 7 isoform X2 [Gossypium raimondii] gi|763806002|gb|KJB72940.1| hypothetical protein B456_011G205300 [Gossypium raimondii] Length = 662 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_002324278.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa] gi|222865712|gb|EEF02843.1| hypothetical protein POPTR_0018s01350g [Populus trichocarpa] Length = 666 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_007013334.1| HCO3- transporter family [Theobroma cacao] gi|508783697|gb|EOY30953.1| HCO3- transporter family [Theobroma cacao] Length = 669 Score = 60.5 bits (145), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGL+GL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLIGLPPSNGVLPQSPMHTKSLAVLKRQIIRK 378 >ref|XP_007226316.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica] gi|462423252|gb|EMJ27515.1| hypothetical protein PRUPE_ppa021289mg, partial [Prunus persica] Length = 647 Score = 60.5 bits (145), Expect = 3e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_009389936.1| PREDICTED: boron transporter 4-like isoform X3 [Musa acuminata subsp. malaccensis] Length = 683 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LVCGLLGIPPSNGVLPQSPMHTKSLAVLKRRIIRK 378 >ref|XP_009389934.1| PREDICTED: boron transporter 4-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 693 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LVCGLLGIPPSNGVLPQSPMHTKSLAVLKRRIIRK 378 >ref|XP_009389933.1| PREDICTED: boron transporter 4-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 706 Score = 60.1 bits (144), Expect = 3e-06 Identities = 25/35 (71%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LVCGLLGIPPSNGVLPQSPMHTKSLAVLKRRIIRK 378 >ref|XP_009334783.1| PREDICTED: probable boron transporter 6 isoform X2 [Pyrus x bretschneideri] Length = 658 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LVCGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_009334782.1| PREDICTED: probable boron transporter 6 isoform X1 [Pyrus x bretschneideri] Length = 682 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LVCGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_008394033.1| PREDICTED: probable boron transporter 6 isoform X3 [Malus domestica] gi|658003065|ref|XP_008394034.1| PREDICTED: probable boron transporter 6 isoform X3 [Malus domestica] Length = 651 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 337 LVCGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 371 >ref|XP_008394032.1| PREDICTED: probable boron transporter 6 isoform X2 [Malus domestica] Length = 658 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LVCGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_008394031.1| PREDICTED: probable boron transporter 6 isoform X1 [Malus domestica] Length = 682 Score = 60.1 bits (144), Expect = 3e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VL+R V+RK Sbjct: 344 LVCGLLGLPPSNGVLPQSPMHTKSLAVLRRQVIRK 378 >ref|XP_014503344.1| PREDICTED: LOW QUALITY PROTEIN: probable boron transporter 7 [Vigna radiata var. radiata] Length = 872 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VL+R +VRK Sbjct: 420 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQMVRK 454 >gb|KOM25773.1| hypothetical protein LR48_Vigan187s001300 [Vigna angularis] Length = 643 Score = 59.7 bits (143), Expect = 4e-06 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL VL+R +VRK Sbjct: 337 LICGLLGLPPSNGVLPQSPMHTKSLAVLRRQMVRK 371 >ref|XP_012447513.1| PREDICTED: boron transporter 4 isoform X1 [Gossypium raimondii] gi|823229550|ref|XP_012447514.1| PREDICTED: boron transporter 4 isoform X1 [Gossypium raimondii] Length = 705 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL+VLK+ ++RK Sbjct: 343 LICGLLGLPPSNGVLPQSPMHTKSLSVLKKQLIRK 377 >ref|XP_012447515.1| PREDICTED: boron transporter 4 isoform X2 [Gossypium raimondii] gi|763786908|gb|KJB53904.1| hypothetical protein B456_009G010600 [Gossypium raimondii] Length = 673 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLGL P+NGV P+SPMHTKSL+VLK+ ++RK Sbjct: 343 LICGLLGLPPSNGVLPQSPMHTKSLSVLKKQLIRK 377 >ref|XP_010914933.1| PREDICTED: boron transporter 4-like [Elaeis guineensis] Length = 669 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGIPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >ref|XP_008792146.1| PREDICTED: boron transporter 4-like [Phoenix dactylifera] Length = 671 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 LICGLLG+ P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 344 LICGLLGIPPSNGVLPQSPMHTKSLAVLKRQLIRK 378 >gb|ABR18319.1| unknown [Picea sitchensis] Length = 671 Score = 59.7 bits (143), Expect = 4e-06 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = -2 Query: 1115 LICGLLGLAPTNGVFPKSPMHTKSLTVLKRTVVRK 1011 L+CGLLGL P+NGV P+SPMHTKSL VLKR ++RK Sbjct: 347 LLCGLLGLPPSNGVLPQSPMHTKSLAVLKRQMIRK 381