BLASTX nr result
ID: Papaver29_contig00017009
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00017009 (408 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis] gi|58... 49 2e-06 >ref|XP_010102187.1| GDSL esterase/lipase [Morus notabilis] gi|587904934|gb|EXB93130.1| GDSL esterase/lipase [Morus notabilis] Length = 367 Score = 48.5 bits (114), Expect(2) = 2e-06 Identities = 20/34 (58%), Positives = 26/34 (76%) Frame = -2 Query: 359 FVTSKIACCAQEPSNGIRLCTVATKHCFDRDVSA 258 FVTSK+ACC Q P NG+ LCT+A+ C +RD+ A Sbjct: 292 FVTSKVACCGQGPYNGLGLCTIASNLCPNRDIYA 325 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 402 NAFEMHNNFISNPQ 361 NAFEMH +FISNPQ Sbjct: 275 NAFEMHMDFISNPQ 288