BLASTX nr result
ID: Papaver29_contig00016899
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00016899 (528 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010264511.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 57 5e-06 ref|XP_010264510.1| PREDICTED: F-box/LRR-repeat protein 3-like i... 57 5e-06 >ref|XP_010264511.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X2 [Nelumbo nucifera] Length = 564 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 526 GICLNITNEGLIHVGMHCPKLVELDLYRAGDV 431 GICLNIT+EGL HVGM CPKL+ELDLYR + Sbjct: 438 GICLNITDEGLTHVGMSCPKLIELDLYRCAGI 469 >ref|XP_010264510.1| PREDICTED: F-box/LRR-repeat protein 3-like isoform X1 [Nelumbo nucifera] Length = 662 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/32 (75%), Positives = 27/32 (84%) Frame = -3 Query: 526 GICLNITNEGLIHVGMHCPKLVELDLYRAGDV 431 GICLNIT+EGL HVGM CPKL+ELDLYR + Sbjct: 438 GICLNITDEGLTHVGMSCPKLIELDLYRCAGI 469