BLASTX nr result
ID: Papaver29_contig00015263
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00015263 (915 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012064972.1| PREDICTED: very-long-chain (3R)-3-hydroxyacy... 59 7e-06 >ref|XP_012064972.1| PREDICTED: very-long-chain (3R)-3-hydroxyacyl-CoA dehydratase 2 [Jatropha curcas] gi|643738201|gb|KDP44189.1| hypothetical protein JCGZ_05656 [Jatropha curcas] Length = 218 Score = 58.5 bits (140), Expect = 7e-06 Identities = 28/54 (51%), Positives = 37/54 (68%) Frame = +3 Query: 753 NVLSILFVLSKKIMFFIYS*HFMLIQIIRYSHYALNCAGFSPFWITYLRYTAFI 914 N++ + + S I F ++S L ++IRYSHYALNC G P W+TYLRYTAFI Sbjct: 91 NIVEVRELPSVFITFLVWS----LAEVIRYSHYALNCLGNCPSWLTYLRYTAFI 140