BLASTX nr result
ID: Papaver29_contig00013746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00013746 (1077 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002280919.1| PREDICTED: pentatricopeptide repeat-containi... 97 2e-17 ref|XP_010103050.1| hypothetical protein L484_001881 [Morus nota... 94 1e-16 ref|XP_012451070.1| PREDICTED: pentatricopeptide repeat-containi... 92 7e-16 ref|XP_012451066.1| PREDICTED: pentatricopeptide repeat-containi... 92 1e-15 gb|KHG06177.1| Pentatricopeptide repeat-containing -like protein... 92 1e-15 emb|CBI20894.3| unnamed protein product [Vitis vinifera] 91 2e-15 ref|XP_002281569.1| PREDICTED: pentatricopeptide repeat-containi... 91 2e-15 emb|CAN61517.1| hypothetical protein VITISV_033966 [Vitis vinifera] 91 2e-15 ref|XP_010656318.1| PREDICTED: pentatricopeptide repeat-containi... 89 6e-15 ref|XP_011459011.1| PREDICTED: pentatricopeptide repeat-containi... 85 9e-14 emb|CDP03324.1| unnamed protein product [Coffea canephora] 84 2e-13 ref|XP_008463396.1| PREDICTED: pentatricopeptide repeat-containi... 84 2e-13 ref|XP_012076705.1| PREDICTED: pentatricopeptide repeat-containi... 84 3e-13 ref|XP_002324819.2| hypothetical protein POPTR_0018s00800g [Popu... 84 3e-13 ref|XP_011026579.1| PREDICTED: pentatricopeptide repeat-containi... 83 4e-13 ref|XP_007221974.1| hypothetical protein PRUPE_ppa002759mg [Prun... 83 4e-13 ref|XP_007013155.1| Pentatricopeptide repeat-containing protein ... 82 1e-12 ref|XP_008220030.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-12 ref|XP_006584832.1| PREDICTED: pentatricopeptide repeat-containi... 80 4e-12 ref|XP_010049671.1| PREDICTED: pentatricopeptide repeat-containi... 79 6e-12 >ref|XP_002280919.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X3 [Vitis vinifera] gi|731406909|ref|XP_010656320.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X3 [Vitis vinifera] gi|731406912|ref|XP_010656321.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X3 [Vitis vinifera] gi|297738818|emb|CBI28063.3| unnamed protein product [Vitis vinifera] Length = 636 Score = 97.1 bits (240), Expect = 2e-17 Identities = 50/90 (55%), Positives = 64/90 (71%) Frame = -3 Query: 304 REKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRT 125 R+ TN+S +RVQA+ E K+Q +S S SQIQ +C++C SC+TVRSRT Sbjct: 18 RDGTNTSK--KRVQASSVMESPLHEKDQLQSVSTSMDSQIQSRCLVCLGNNSCRTVRSRT 75 Query: 124 KLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 KLMNILI+KG P+EAQ IFN+L EEGH+PT Sbjct: 76 KLMNILIEKGKPQEAQLIFNSLTEEGHRPT 105 >ref|XP_010103050.1| hypothetical protein L484_001881 [Morus notabilis] gi|587906616|gb|EXB94673.1| hypothetical protein L484_001881 [Morus notabilis] Length = 629 Score = 94.4 bits (233), Expect = 1e-16 Identities = 45/90 (50%), Positives = 60/90 (66%) Frame = -3 Query: 304 REKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRT 125 R + + ++ ERVQ + E H K + S S S IQ +C++C SC+TVRSRT Sbjct: 3 RSQEGTITSKERVQTSPIMESHMHKKEKVQVFSNSIDSHIQSRCLVCLGNNSCRTVRSRT 62 Query: 124 KLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 KLMNILI++G P E QTIFN+L+EEGH+PT Sbjct: 63 KLMNILIERGRPHEVQTIFNSLVEEGHRPT 92 >ref|XP_012451070.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Gossypium raimondii] Length = 595 Score = 92.0 bits (227), Expect = 7e-16 Identities = 43/73 (58%), Positives = 55/73 (75%) Frame = -3 Query: 253 SNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTPKEAQT 74 S H + K Q +P + S+ S++ KC++CS SCQTVR+RTKLMNILI+KG P+EAQ Sbjct: 2 SQVSHVDEKEQSHPGTGSADSEVSSKCIVCSGNNSCQTVRARTKLMNILIEKGKPQEAQF 61 Query: 73 IFNTLIEEGHKPT 35 IFN+L EEGHKPT Sbjct: 62 IFNSLTEEGHKPT 74 >ref|XP_012451066.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Gossypium raimondii] gi|823236827|ref|XP_012451067.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Gossypium raimondii] gi|823236829|ref|XP_012451068.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Gossypium raimondii] gi|823236831|ref|XP_012451069.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Gossypium raimondii] gi|763797961|gb|KJB64916.1| hypothetical protein B456_010G072200 [Gossypium raimondii] gi|763797962|gb|KJB64917.1| hypothetical protein B456_010G072200 [Gossypium raimondii] Length = 632 Score = 91.7 bits (226), Expect = 1e-15 Identities = 44/78 (56%), Positives = 58/78 (74%) Frame = -3 Query: 268 VQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTP 89 V+A+ H + K Q +P + S+ S++ KC++CS SCQTVR+RTKLMNILI+KG P Sbjct: 34 VKASAVVVSHVDEKEQSHPGTGSADSEVSSKCIVCSGNNSCQTVRARTKLMNILIEKGKP 93 Query: 88 KEAQTIFNTLIEEGHKPT 35 +EAQ IFN+L EEGHKPT Sbjct: 94 QEAQFIFNSLTEEGHKPT 111 >gb|KHG06177.1| Pentatricopeptide repeat-containing -like protein [Gossypium arboreum] Length = 632 Score = 91.7 bits (226), Expect = 1e-15 Identities = 44/78 (56%), Positives = 58/78 (74%) Frame = -3 Query: 268 VQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTP 89 V+A+ H + K Q +P + S+ S++ KC++CS SCQTVR+RTKLMNILI+KG P Sbjct: 34 VKASAVVVSHVDEKEQSHPGTDSADSEVSSKCIVCSGNNSCQTVRARTKLMNILIEKGRP 93 Query: 88 KEAQTIFNTLIEEGHKPT 35 +EAQ IFN+L EEGHKPT Sbjct: 94 QEAQFIFNSLTEEGHKPT 111 >emb|CBI20894.3| unnamed protein product [Vitis vinifera] Length = 608 Score = 90.9 bits (224), Expect = 2e-15 Identities = 45/106 (42%), Positives = 71/106 (66%), Gaps = 11/106 (10%) Frame = -3 Query: 319 MEESRREKTNSSSNVER-----------VQAAHSNEQHRELKNQRNPISRSSSSQIQLKC 173 MEES E+ +S + E V+A + + R+ K++ +P+S+S+ Q Q++C Sbjct: 1 MEESGNERAHSDAPTEHQDGTTDVKKEEVEALQTEVKRRDGKHELHPVSQSADPQSQVRC 60 Query: 172 MICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 + C +K SC+TVRSRTKLMNI+I+KG P+E Q+I +++IE GHKP+ Sbjct: 61 ISCLSKTSCRTVRSRTKLMNIMIEKGRPQEVQSILDSIIEGGHKPS 106 >ref|XP_002281569.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] gi|731385503|ref|XP_010648524.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] gi|731385505|ref|XP_010648525.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] gi|731385507|ref|XP_010648526.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] gi|731385510|ref|XP_010648527.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] gi|731385512|ref|XP_010648528.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Vitis vinifera] Length = 635 Score = 90.9 bits (224), Expect = 2e-15 Identities = 45/106 (42%), Positives = 71/106 (66%), Gaps = 11/106 (10%) Frame = -3 Query: 319 MEESRREKTNSSSNVER-----------VQAAHSNEQHRELKNQRNPISRSSSSQIQLKC 173 MEES E+ +S + E V+A + + R+ K++ +P+S+S+ Q Q++C Sbjct: 1 MEESGNERAHSDAPTEHQDGTTDVKKEEVEALQTEVKRRDGKHELHPVSQSADPQSQVRC 60 Query: 172 MICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 + C +K SC+TVRSRTKLMNI+I+KG P+E Q+I +++IE GHKP+ Sbjct: 61 ISCLSKTSCRTVRSRTKLMNIMIEKGRPQEVQSILDSIIEGGHKPS 106 >emb|CAN61517.1| hypothetical protein VITISV_033966 [Vitis vinifera] Length = 635 Score = 90.9 bits (224), Expect = 2e-15 Identities = 45/106 (42%), Positives = 71/106 (66%), Gaps = 11/106 (10%) Frame = -3 Query: 319 MEESRREKTNSSSNVER-----------VQAAHSNEQHRELKNQRNPISRSSSSQIQLKC 173 MEES E+ +S + E V+A + + R+ K++ +P+S+S+ Q Q++C Sbjct: 1 MEESGNERAHSDAPTEHQDGTTDAKKEEVEALQTEVKRRDGKHELHPVSQSADPQSQVRC 60 Query: 172 MICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 + C +K SC+TVRSRTKLMNI+I+KG P+E Q+I +++IE GHKP+ Sbjct: 61 ISCLSKTSCRTVRSRTKLMNIMIEKGRPQEVQSILDSIIEGGHKPS 106 >ref|XP_010656318.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X1 [Vitis vinifera] gi|731406907|ref|XP_010656319.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 isoform X2 [Vitis vinifera] Length = 654 Score = 89.0 bits (219), Expect = 6e-15 Identities = 41/65 (63%), Positives = 51/65 (78%) Frame = -3 Query: 229 KNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNTLIEE 50 K+Q +S S SQIQ +C++C SC+TVRSRTKLMNILI+KG P+EAQ IFN+L EE Sbjct: 59 KDQLQSVSTSMDSQIQSRCLVCLGNNSCRTVRSRTKLMNILIEKGKPQEAQLIFNSLTEE 118 Query: 49 GHKPT 35 GH+PT Sbjct: 119 GHRPT 123 >ref|XP_011459011.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Fragaria vesca subsp. vesca] Length = 632 Score = 85.1 bits (209), Expect = 9e-14 Identities = 44/94 (46%), Positives = 62/94 (65%), Gaps = 2/94 (2%) Frame = -3 Query: 310 SRREKTNSSSNVE--RVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTV 137 SR KT+ + V RVQ+ E +++ KN+ S+S S Q C++C + SC+ V Sbjct: 11 SRATKTSEEATVTNGRVQSLPIKETYQDDKNRLRLDSKSLDSLSQPHCLVCMNRDSCRIV 70 Query: 136 RSRTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 RSRTKLMN LI++G P+E Q+IFN LIEEGH+P+ Sbjct: 71 RSRTKLMNTLIERGKPQEVQSIFNALIEEGHRPS 104 >emb|CDP03324.1| unnamed protein product [Coffea canephora] Length = 630 Score = 84.3 bits (207), Expect = 2e-13 Identities = 41/86 (47%), Positives = 56/86 (65%) Frame = -3 Query: 292 NSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMN 113 N S+ + A S+++ K+ PI S +S+IQ C++CS SCQTVRSRTKLMN Sbjct: 18 NGSATSKSHNQASSSKESVSNKDLTAPIPASVTSEIQFGCLVCSGNNSCQTVRSRTKLMN 77 Query: 112 ILIDKGTPKEAQTIFNTLIEEGHKPT 35 ILI+KG P E ++F L EEGH+P+ Sbjct: 78 ILIEKGKPHEVHSVFRDLTEEGHRPS 103 >ref|XP_008463396.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like [Cucumis melo] Length = 609 Score = 84.3 bits (207), Expect = 2e-13 Identities = 37/65 (56%), Positives = 51/65 (78%) Frame = -3 Query: 229 KNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNTLIEE 50 KNQ +S SQIQ +C++C SC+TVRSRTKLMNIL+++G P+EA+ IFN+L+E+ Sbjct: 27 KNQVKLVSTPVDSQIQSRCLLCLGNNSCRTVRSRTKLMNILVERGKPQEAEFIFNSLVEQ 86 Query: 49 GHKPT 35 GH+PT Sbjct: 87 GHRPT 91 >ref|XP_012076705.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like [Jatropha curcas] gi|643724482|gb|KDP33683.1| hypothetical protein JCGZ_07254 [Jatropha curcas] Length = 622 Score = 83.6 bits (205), Expect = 3e-13 Identities = 42/90 (46%), Positives = 58/90 (64%) Frame = -3 Query: 304 REKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRT 125 +++ + ++ + V+ + E H +NQ IS S SQ+Q C C K SC+TVRSRT Sbjct: 3 KQRNGTITSSKLVEPSTVMELHSPEENQFQLISSSVDSQVQSCCSACLGKNSCRTVRSRT 62 Query: 124 KLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 KLMN LI++G P EA IFN LIE+GH+PT Sbjct: 63 KLMNTLIERGKPHEAHLIFNNLIEDGHRPT 92 >ref|XP_002324819.2| hypothetical protein POPTR_0018s00800g [Populus trichocarpa] gi|550317744|gb|EEF03384.2| hypothetical protein POPTR_0018s00800g [Populus trichocarpa] Length = 610 Score = 83.6 bits (205), Expect = 3e-13 Identities = 41/92 (44%), Positives = 60/92 (65%) Frame = -3 Query: 310 SRREKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRS 131 S++ + +++ +R A E + + NQ P S S Q + C C+TK SC+TVRS Sbjct: 14 SKKNQAGTATIKKRWVALPVKENNPDHMNQLRPASESMEFQRAIGCKFCTTKDSCRTVRS 73 Query: 130 RTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 RTKLMN L++KG P+EA++IF +LIE GHKP+ Sbjct: 74 RTKLMNFLVEKGKPQEAESIFYSLIEGGHKPS 105 >ref|XP_011026579.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Populus euphratica] gi|743841939|ref|XP_011026581.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Populus euphratica] Length = 637 Score = 82.8 bits (203), Expect = 4e-13 Identities = 41/92 (44%), Positives = 59/92 (64%) Frame = -3 Query: 310 SRREKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRS 131 S++ + +++ +R A E + + NQ P S S Q + C C TK SC+TVRS Sbjct: 14 SKKNQAGTATIKKRWVALPVKENNPDHMNQLRPASESMEFQRAIGCKFCMTKDSCRTVRS 73 Query: 130 RTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 RTKLMN L++KG P+EA++IF +LIE GHKP+ Sbjct: 74 RTKLMNFLVEKGKPQEAESIFYSLIEGGHKPS 105 >ref|XP_007221974.1| hypothetical protein PRUPE_ppa002759mg [Prunus persica] gi|462418910|gb|EMJ23173.1| hypothetical protein PRUPE_ppa002759mg [Prunus persica] Length = 636 Score = 82.8 bits (203), Expect = 4e-13 Identities = 41/92 (44%), Positives = 60/92 (65%) Frame = -3 Query: 310 SRREKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRS 131 ++ E+ +++ RVQA H + KN IS+ + S Q C IC K +C+ VRS Sbjct: 15 NKNEEATATTANGRVQALPIKGNHPDDKNHLRLISKPNGSMRQSHCSICMAKENCRIVRS 74 Query: 130 RTKLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 RT+LMNILI++G P+EAQ++FN LIE GH+P+ Sbjct: 75 RTRLMNILIERGRPQEAQSLFNGLIEGGHRPS 106 >ref|XP_007013155.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508783518|gb|EOY30774.1| Pentatricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 611 Score = 81.6 bits (200), Expect = 1e-12 Identities = 37/69 (53%), Positives = 51/69 (73%) Frame = -3 Query: 241 HRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIFNT 62 H + K+Q N ++ S+ S+++ KC+ C C+TV +RTKLMNILI KG P+EA +IFN+ Sbjct: 24 HVDEKDQSNSVTPSADSEVKSKCIGCLGNNGCRTVHARTKLMNILIGKGKPQEAHSIFNS 83 Query: 61 LIEEGHKPT 35 L EEGHKPT Sbjct: 84 LTEEGHKPT 92 >ref|XP_008220030.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Prunus mume] gi|645226421|ref|XP_008220031.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630 [Prunus mume] Length = 636 Score = 79.7 bits (195), Expect = 4e-12 Identities = 40/90 (44%), Positives = 58/90 (64%) Frame = -3 Query: 310 SRREKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRS 131 ++ E+ +++ RVQA H + KN IS+ + S Q C IC K +C+ VRS Sbjct: 15 NKNEEATATTANGRVQALPIKGNHPDDKNHLRLISKPNGSMRQSHCSICMAKENCRIVRS 74 Query: 130 RTKLMNILIDKGTPKEAQTIFNTLIEEGHK 41 RT+LMNILI++G P+EAQ++FN LIE GH+ Sbjct: 75 RTRLMNILIERGRPQEAQSLFNGLIEGGHR 104 >ref|XP_006584832.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X1 [Glycine max] gi|571469811|ref|XP_006584833.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X2 [Glycine max] gi|571469813|ref|XP_006584834.1| PREDICTED: pentatricopeptide repeat-containing protein At5g21222-like isoform X3 [Glycine max] gi|947092983|gb|KRH41568.1| hypothetical protein GLYMA_08G038200 [Glycine max] gi|947092984|gb|KRH41569.1| hypothetical protein GLYMA_08G038200 [Glycine max] gi|947092985|gb|KRH41570.1| hypothetical protein GLYMA_08G038200 [Glycine max] gi|947092986|gb|KRH41571.1| hypothetical protein GLYMA_08G038200 [Glycine max] gi|947092987|gb|KRH41572.1| hypothetical protein GLYMA_08G038200 [Glycine max] Length = 621 Score = 79.7 bits (195), Expect = 4e-12 Identities = 39/71 (54%), Positives = 45/71 (63%) Frame = -3 Query: 247 EQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRTKLMNILIDKGTPKEAQTIF 68 +QH+ KNQ S + Q C+IC SCQTV +RTKLMN LI KG P EAQ +F Sbjct: 24 KQHQYKKNQPKLSSTPQERRDQSHCLICRGNNSCQTVHARTKLMNTLIGKGKPHEAQAVF 83 Query: 67 NTLIEEGHKPT 35 N L EEGHKPT Sbjct: 84 NNLTEEGHKPT 94 >ref|XP_010049671.1| PREDICTED: pentatricopeptide repeat-containing protein At5g25630-like [Eucalyptus grandis] gi|629117739|gb|KCW82414.1| hypothetical protein EUGRSUZ_C03818 [Eucalyptus grandis] Length = 622 Score = 79.0 bits (193), Expect = 6e-12 Identities = 39/90 (43%), Positives = 62/90 (68%) Frame = -3 Query: 304 REKTNSSSNVERVQAAHSNEQHRELKNQRNPISRSSSSQIQLKCMICSTKGSCQTVRSRT 125 +++ + S+ ++V+++ E+ + N +S SSS + Q C+IC + SC+TVRSRT Sbjct: 3 KQQEGTISSKKQVESSPIMERLLQEDNHFQSVSSSSSLENQSCCLICLSNNSCRTVRSRT 62 Query: 124 KLMNILIDKGTPKEAQTIFNTLIEEGHKPT 35 KLMNILI++ P+EA +IF+ L EEGH+PT Sbjct: 63 KLMNILIERKKPQEAHSIFDCLTEEGHRPT 92