BLASTX nr result
ID: Papaver29_contig00013332
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00013332 (544 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010241408.1| PREDICTED: mediator-associated protein 1-lik... 59 1e-06 ref|XP_010241033.1| PREDICTED: mediator-associated protein 1-lik... 57 5e-06 >ref|XP_010241408.1| PREDICTED: mediator-associated protein 1-like [Nelumbo nucifera] Length = 412 Score = 58.9 bits (141), Expect = 1e-06 Identities = 31/68 (45%), Positives = 43/68 (63%) Frame = -2 Query: 543 LEAFRENKNGPTLGESLLTEGLALLGDSIAKEWEKKWRKFNEEEAEVYLKRVDLVRELTT 364 +E+FR P GE ++ EGL L+G S KE E++WRK + EE E+YLKRVDL R+ Sbjct: 346 MESFRLR---PDFGEDIVKEGLGLMGSSKLKELEERWRKLHMEEIEMYLKRVDLFRDQLK 402 Query: 363 EVLKAVKS 340 + A+ S Sbjct: 403 MLFDALGS 410 >ref|XP_010241033.1| PREDICTED: mediator-associated protein 1-like [Nelumbo nucifera] Length = 423 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/61 (45%), Positives = 39/61 (63%) Frame = -2 Query: 513 PTLGESLLTEGLALLGDSIAKEWEKKWRKFNEEEAEVYLKRVDLVRELTTEVLKAVKSSD 334 P GE ++ EGL L+G+S KE E++WRK + E E+YLKRVDL R+ + A+ S Sbjct: 360 PDFGEGIVKEGLGLMGNSKVKELEERWRKLHMSEIEMYLKRVDLFRDQLKMLYDALGSKM 419 Query: 333 S 331 S Sbjct: 420 S 420