BLASTX nr result
ID: Papaver29_contig00012180
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00012180 (441 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004250136.1| PREDICTED: ATP-dependent 6-phosphofructokina... 56 9e-06 >ref|XP_004250136.1| PREDICTED: ATP-dependent 6-phosphofructokinase 5, chloroplastic [Solanum lycopersicum] Length = 532 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/45 (55%), Positives = 34/45 (75%) Frame = -1 Query: 294 VHRAGPGEKIYLKPEEVAAPILTCGGLCPVVSLML*DRLVQLQSF 160 VHRAGP EKIY KPEEV A I+TCGGLCP ++ ++ ++ L+ + Sbjct: 159 VHRAGPREKIYFKPEEVKAAIITCGGLCPGLNDVIRQIVITLEIY 203