BLASTX nr result
ID: Papaver29_contig00010744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00010744 (486 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844033.1| PREDICTED: probable protein S-acyltransferas... 57 4e-06 >ref|XP_012844033.1| PREDICTED: probable protein S-acyltransferase 7 [Erythranthe guttatus] gi|604321263|gb|EYU31851.1| hypothetical protein MIMGU_mgv1a006331mg [Erythranthe guttata] Length = 448 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/35 (77%), Positives = 29/35 (82%), Gaps = 1/35 (2%) Frame = +2 Query: 383 SDP-RGLTNGMDTPRVYQTWKGNNRFFLQGRFIFG 484 SDP G TNG D RVYQTWKG+N+FFLQGRFIFG Sbjct: 10 SDPLSGSTNGSDELRVYQTWKGSNKFFLQGRFIFG 44