BLASTX nr result
ID: Papaver29_contig00010585
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00010585 (1456 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012833645.1| PREDICTED: poly [ADP-ribose] polymerase 2 is... 54 9e-06 ref|XP_012833652.1| PREDICTED: poly [ADP-ribose] polymerase 2 is... 54 9e-06 >ref|XP_012833645.1| PREDICTED: poly [ADP-ribose] polymerase 2 isoform X1 [Erythranthe guttatus] Length = 724 Score = 54.3 bits (129), Expect(2) = 9e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 150 QGELLHNGYMVYNVDQIRMRHLIHVNFNYKW 242 +G LL+N Y+VYNVDQIRMR+L+HVNFN+K+ Sbjct: 694 KGSLLYNEYIVYNVDQIRMRYLVHVNFNFKY 724 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 6/27 (22%) Frame = +1 Query: 1 PDPSEFEA------VPLGKPKRQRDRK 63 PD SE + VPLGKPK Q RK Sbjct: 668 PDLSEAQTLENGVLVPLGKPKEQPGRK 694 >ref|XP_012833652.1| PREDICTED: poly [ADP-ribose] polymerase 2 isoform X2 [Erythranthe guttatus] gi|604348580|gb|EYU46735.1| hypothetical protein MIMGU_mgv1a020376mg [Erythranthe guttata] Length = 700 Score = 54.3 bits (129), Expect(2) = 9e-06 Identities = 22/31 (70%), Positives = 29/31 (93%) Frame = +3 Query: 150 QGELLHNGYMVYNVDQIRMRHLIHVNFNYKW 242 +G LL+N Y+VYNVDQIRMR+L+HVNFN+K+ Sbjct: 670 KGSLLYNEYIVYNVDQIRMRYLVHVNFNFKY 700 Score = 24.6 bits (52), Expect(2) = 9e-06 Identities = 14/27 (51%), Positives = 15/27 (55%), Gaps = 6/27 (22%) Frame = +1 Query: 1 PDPSEFEA------VPLGKPKRQRDRK 63 PD SE + VPLGKPK Q RK Sbjct: 644 PDLSEAQTLENGVLVPLGKPKEQPGRK 670