BLASTX nr result
ID: Papaver29_contig00010476
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00010476 (491 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007221961.1| hypothetical protein PRUPE_ppa001780mg [Prun... 87 4e-15 ref|XP_007221960.1| hypothetical protein PRUPE_ppa001780mg [Prun... 87 4e-15 ref|XP_010266423.1| PREDICTED: WD and tetratricopeptide repeats ... 86 8e-15 ref|XP_008378629.1| PREDICTED: WD and tetratricopeptide repeats ... 86 8e-15 ref|XP_009342574.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_009342573.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_009373747.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_009373740.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_008338918.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_008338917.1| PREDICTED: WD and tetratricopeptide repeats ... 86 1e-14 ref|XP_008219416.1| PREDICTED: WD and tetratricopeptide repeats ... 85 2e-14 ref|XP_011464639.1| PREDICTED: WD and tetratricopeptide repeats ... 85 2e-14 ref|XP_004299706.1| PREDICTED: WD and tetratricopeptide repeats ... 85 2e-14 ref|XP_002514012.1| WD and tetratricopeptide repeat protein, put... 84 5e-14 ref|XP_010519610.1| PREDICTED: WD and tetratricopeptide repeats ... 83 7e-14 ref|XP_007018174.1| WD and tetratricopeptide repeat protein, put... 83 7e-14 ref|XP_007018173.1| WD and tetratricopeptide repeat protein, put... 83 7e-14 ref|XP_007018172.1| WD and tetratricopeptide repeat protein, put... 83 7e-14 ref|XP_007018171.1| WD and tetratricopeptide repeat protein, put... 83 7e-14 ref|XP_007018170.1| WD and tetratricopeptide repeat protein, put... 83 7e-14 >ref|XP_007221961.1| hypothetical protein PRUPE_ppa001780mg [Prunus persica] gi|462418897|gb|EMJ23160.1| hypothetical protein PRUPE_ppa001780mg [Prunus persica] Length = 765 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D IDSR V++RN+ ++ LQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIDSRYVDVRNNGNHSLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_007221960.1| hypothetical protein PRUPE_ppa001780mg [Prunus persica] gi|462418896|gb|EMJ23159.1| hypothetical protein PRUPE_ppa001780mg [Prunus persica] Length = 749 Score = 87.4 bits (215), Expect = 4e-15 Identities = 41/54 (75%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D IDSR V++RN+ ++ LQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIDSRYVDVRNNGNHSLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_010266423.1| PREDICTED: WD and tetratricopeptide repeats protein 1 [Nelumbo nucifera] Length = 763 Score = 86.3 bits (212), Expect = 8e-15 Identities = 36/55 (65%), Positives = 47/55 (85%) Frame = -1 Query: 206 NFSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 NFSDGNI D ++SR ++ D++ +LQMHSSL++RLS E+ELEGHQGCVN+VAWN Sbjct: 5 NFSDGNIYDLLESRTIDFHYDVNQKLQMHSSLIQRLSLEKELEGHQGCVNAVAWN 59 >ref|XP_008378629.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Malus domestica] Length = 203 Score = 86.3 bits (212), Expect = 8e-15 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I+ R V++R+D + RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIERRYVDVRHDANQRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_009342574.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like isoform X2 [Pyrus x bretschneideri] Length = 763 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_009342573.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like isoform X1 [Pyrus x bretschneideri] Length = 765 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_009373747.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like isoform X2 [Pyrus x bretschneideri] Length = 763 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_009373740.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like isoform X1 [Pyrus x bretschneideri] Length = 765 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_008338918.1| PREDICTED: WD and tetratricopeptide repeats protein 1 isoform X2 [Malus domestica] Length = 763 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_008338917.1| PREDICTED: WD and tetratricopeptide repeats protein 1 isoform X1 [Malus domestica] Length = 765 Score = 85.9 bits (211), Expect = 1e-14 Identities = 40/54 (74%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I R V++R+D ++RLQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIARRYVDVRHDANHRLQMHSSLVRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_008219416.1| PREDICTED: WD and tetratricopeptide repeats protein 1 [Prunus mume] Length = 802 Score = 85.1 bits (209), Expect = 2e-14 Identities = 39/52 (75%), Positives = 46/52 (88%) Frame = -1 Query: 197 DGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 DGNI D I+SR V++RN+ ++ LQMHSSLVRRLS ERELEGHQGCVNS+AWN Sbjct: 45 DGNIHDLIESRYVDVRNNGNHSLQMHSSLVRRLSLERELEGHQGCVNSIAWN 96 >ref|XP_011464639.1| PREDICTED: WD and tetratricopeptide repeats protein 1 isoform X1 [Fragaria vesca subsp. vesca] Length = 764 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I+SR +++R D+++ LQMHSSLVRRLS E ELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIESRYLDVRQDVNHSLQMHSSLVRRLSQETELEGHQGCVNSIAWN 59 >ref|XP_004299706.1| PREDICTED: WD and tetratricopeptide repeats protein 1 isoform X2 [Fragaria vesca subsp. vesca] Length = 762 Score = 84.7 bits (208), Expect = 2e-14 Identities = 38/54 (70%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI D I+SR +++R D+++ LQMHSSLVRRLS E ELEGHQGCVNS+AWN Sbjct: 6 FHDGNIHDLIESRYLDVRQDVNHSLQMHSSLVRRLSQETELEGHQGCVNSIAWN 59 >ref|XP_002514012.1| WD and tetratricopeptide repeat protein, putative [Ricinus communis] gi|223547098|gb|EEF48595.1| WD and tetratricopeptide repeat protein, putative [Ricinus communis] Length = 761 Score = 83.6 bits (205), Expect = 5e-14 Identities = 37/54 (68%), Positives = 46/54 (85%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGNI +F+++R + R DI++ LQMHSSL+RRLS ERELEGHQGCVNS+AWN Sbjct: 6 FHDGNIYNFLETRYFDSRRDINHSLQMHSSLIRRLSQERELEGHQGCVNSIAWN 59 >ref|XP_010519610.1| PREDICTED: WD and tetratricopeptide repeats protein 1-like [Tarenaya hassleriana] Length = 755 Score = 83.2 bits (204), Expect = 7e-14 Identities = 37/55 (67%), Positives = 47/55 (85%) Frame = -1 Query: 206 NFSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 +F DGNI + I+ R+VE +D+D RLQ+HSSL+RRLS ERELEGHQGCVN++AWN Sbjct: 5 SFHDGNIYNLIERRSVEQNHDVDQRLQIHSSLIRRLSQERELEGHQGCVNALAWN 59 >ref|XP_007018174.1| WD and tetratricopeptide repeat protein, putative isoform 6 [Theobroma cacao] gi|508723502|gb|EOY15399.1| WD and tetratricopeptide repeat protein, putative isoform 6 [Theobroma cacao] Length = 630 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGN + + SR+++IR+D+D+ LQMHSSL++RLS ERELEGHQGCVN++AWN Sbjct: 6 FHDGNAHNLLKSRHIDIRHDVDHSLQMHSSLIQRLSLERELEGHQGCVNAMAWN 59 >ref|XP_007018173.1| WD and tetratricopeptide repeat protein, putative isoform 5 [Theobroma cacao] gi|508723501|gb|EOY15398.1| WD and tetratricopeptide repeat protein, putative isoform 5 [Theobroma cacao] Length = 703 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGN + + SR+++IR+D+D+ LQMHSSL++RLS ERELEGHQGCVN++AWN Sbjct: 6 FHDGNAHNLLKSRHIDIRHDVDHSLQMHSSLIQRLSLERELEGHQGCVNAMAWN 59 >ref|XP_007018172.1| WD and tetratricopeptide repeat protein, putative isoform 4 [Theobroma cacao] gi|508723500|gb|EOY15397.1| WD and tetratricopeptide repeat protein, putative isoform 4 [Theobroma cacao] Length = 716 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGN + + SR+++IR+D+D+ LQMHSSL++RLS ERELEGHQGCVN++AWN Sbjct: 6 FHDGNAHNLLKSRHIDIRHDVDHSLQMHSSLIQRLSLERELEGHQGCVNAMAWN 59 >ref|XP_007018171.1| WD and tetratricopeptide repeat protein, putative isoform 3 [Theobroma cacao] gi|508723499|gb|EOY15396.1| WD and tetratricopeptide repeat protein, putative isoform 3 [Theobroma cacao] Length = 760 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGN + + SR+++IR+D+D+ LQMHSSL++RLS ERELEGHQGCVN++AWN Sbjct: 6 FHDGNAHNLLKSRHIDIRHDVDHSLQMHSSLIQRLSLERELEGHQGCVNAMAWN 59 >ref|XP_007018170.1| WD and tetratricopeptide repeat protein, putative isoform 2 [Theobroma cacao] gi|508723498|gb|EOY15395.1| WD and tetratricopeptide repeat protein, putative isoform 2 [Theobroma cacao] Length = 759 Score = 83.2 bits (204), Expect = 7e-14 Identities = 35/54 (64%), Positives = 47/54 (87%) Frame = -1 Query: 203 FSDGNIIDFIDSRNVEIRNDIDYRLQMHSSLVRRLSFERELEGHQGCVNSVAWN 42 F DGN + + SR+++IR+D+D+ LQMHSSL++RLS ERELEGHQGCVN++AWN Sbjct: 6 FHDGNAHNLLKSRHIDIRHDVDHSLQMHSSLIQRLSLERELEGHQGCVNAMAWN 59