BLASTX nr result
ID: Papaver29_contig00010315
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00010315 (974 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002462534.1| hypothetical protein SORBIDRAFT_02g027570 [S... 57 8e-07 >ref|XP_002462534.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor] gi|241925911|gb|EER99055.1| hypothetical protein SORBIDRAFT_02g027570 [Sorghum bicolor] Length = 728 Score = 56.6 bits (135), Expect(2) = 8e-07 Identities = 29/42 (69%), Positives = 32/42 (76%), Gaps = 2/42 (4%) Frame = -1 Query: 773 TLLHNSCRW--PMGLKYGSPVEDVMTKLAIQCRGWESVYSEL 654 T HN+ +W MGLKYG PVEDV+T LAI CRGWESVYS L Sbjct: 419 TYEHNT-QWGDEMGLKYGCPVEDVITGLAIHCRGWESVYSNL 459 Score = 25.0 bits (53), Expect(2) = 8e-07 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = -2 Query: 610 LQHKIWSKRLFQIFSQSTFHIWAMKACGKVPSQPGY 503 LQHK WS+ F IF K+P Q GY Sbjct: 477 LQHKRWSEGNFSIFLSKFCPFLYGHGKTKLPHQMGY 512