BLASTX nr result
ID: Papaver29_contig00005454
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00005454 (773 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN44040.1| 60S ribosomal protein L39 [Glycine soja] 67 1e-08 ref|XP_006408437.1| hypothetical protein EUTSA_v10021898mg [Eutr... 66 2e-08 ref|NP_566167.1| 60S ribosomal protein L39-2 [Arabidopsis thalia... 66 3e-08 ref|XP_008378714.1| PREDICTED: 60S ribosomal protein L39-1 [Malu... 66 3e-08 ref|XP_006298912.1| hypothetical protein CARUB_v10015033mg, part... 66 3e-08 ref|XP_002884307.1| 60S ribosomal protein L39 [Arabidopsis lyrat... 65 4e-08 ref|XP_010656573.1| PREDICTED: 60S ribosomal protein L39-3-like ... 65 7e-08 ref|XP_010665831.1| PREDICTED: 60S ribosomal protein L39-3 [Beta... 65 7e-08 emb|CDY62505.1| BnaC04g56360D [Brassica napus] 65 7e-08 gb|KDP38638.1| hypothetical protein JCGZ_03991 [Jatropha curcas] 65 7e-08 emb|CBI25619.3| unnamed protein product [Vitis vinifera] 65 7e-08 emb|CBI25617.3| unnamed protein product [Vitis vinifera] 65 7e-08 ref|XP_006450329.1| hypothetical protein CICLE_v10010138mg [Citr... 65 7e-08 gb|EYU20493.1| hypothetical protein MIMGU_mgv1a017298mg [Erythra... 65 7e-08 ref|XP_013587193.1| PREDICTED: 60S ribosomal protein L39-1-like ... 65 7e-08 ref|XP_002869300.1| 60S ribosomal protein L39 [Arabidopsis lyrat... 65 7e-08 ref|XP_010457149.1| PREDICTED: 60S ribosomal protein L39-2-like ... 64 9e-08 ref|XP_006450330.1| hypothetical protein CICLE_v10010138mg [Citr... 64 1e-07 emb|CBI21094.3| unnamed protein product [Vitis vinifera] 64 2e-07 ref|XP_002523523.1| ribosomal protein L39e, putative [Ricinus co... 64 2e-07 >gb|KHN44040.1| 60S ribosomal protein L39 [Glycine soja] Length = 119 Score = 67.4 bits (163), Expect = 1e-08 Identities = 35/64 (54%), Positives = 40/64 (62%) Frame = +2 Query: 413 GEGSKQERFLSARYVVLTSELEAIMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETK 592 GEG + AR + + A M SHK+F IKKKLAKKMRQNRPIP WIRMRTD + Sbjct: 45 GEGKSEGSIQLARLLRRVQQSAAKMPSHKTFRIKKKLAKKMRQNRPIPYWIRMRTDNTIR 104 Query: 593 TERK 604 K Sbjct: 105 YNAK 108 >ref|XP_006408437.1| hypothetical protein EUTSA_v10021898mg [Eutrema salsugineum] gi|557109583|gb|ESQ49890.1| hypothetical protein EUTSA_v10021898mg [Eutrema salsugineum] Length = 51 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKLAKKMRQNRPIPNWIR+RTD + + K Sbjct: 1 MPSHKTFMIKKKLAKKMRQNRPIPNWIRLRTDNKIRYNAK 40 >ref|NP_566167.1| 60S ribosomal protein L39-2 [Arabidopsis thaliana] gi|75245803|sp|Q8L8W6.1|RL392_ARATH RecName: Full=60S ribosomal protein L39-2 gi|21618028|gb|AAM67078.1| putative ribosomal protein L39 [Arabidopsis thaliana] gi|26452513|dbj|BAC43341.1| putative ribosomal protein L39 [Arabidopsis thaliana] gi|28827238|gb|AAO50463.1| putative ribosomal protein L39 [Arabidopsis thaliana] gi|332640255|gb|AEE73776.1| 60S ribosomal protein L39-2 [Arabidopsis thaliana] Length = 51 Score = 65.9 bits (159), Expect = 3e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKL KKMRQNRPIPNWIR+RTD + + K Sbjct: 1 MPSHKSFMIKKKLGKKMRQNRPIPNWIRLRTDNKIRYNAK 40 >ref|XP_008378714.1| PREDICTED: 60S ribosomal protein L39-1 [Malus domestica] gi|657946419|ref|XP_008384633.1| PREDICTED: 60S ribosomal protein L39-1 [Malus domestica] gi|657971768|ref|XP_008377673.1| PREDICTED: 60S ribosomal protein L39-1 [Malus domestica] gi|658031534|ref|XP_008351241.1| PREDICTED: 60S ribosomal protein L39-1 [Malus domestica] gi|658054232|ref|XP_008362872.1| PREDICTED: 60S ribosomal protein L39-1 [Malus domestica] gi|694312830|ref|XP_009363966.1| PREDICTED: 60S ribosomal protein L39-1 [Pyrus x bretschneideri] gi|694354598|ref|XP_009358487.1| PREDICTED: 60S ribosomal protein L39-1 [Pyrus x bretschneideri] gi|694379950|ref|XP_009366132.1| PREDICTED: 60S ribosomal protein L39-1 [Pyrus x bretschneideri] gi|694428500|ref|XP_009341816.1| PREDICTED: 60S ribosomal protein L39-1 [Pyrus x bretschneideri] gi|694428516|ref|XP_009341824.1| PREDICTED: 60S ribosomal protein L39-1 [Pyrus x bretschneideri] Length = 51 Score = 65.9 bits (159), Expect = 3e-08 Identities = 31/40 (77%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 1 MPSHKSFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 40 >ref|XP_006298912.1| hypothetical protein CARUB_v10015033mg, partial [Capsella rubella] gi|482567621|gb|EOA31810.1| hypothetical protein CARUB_v10015033mg, partial [Capsella rubella] Length = 74 Score = 65.9 bits (159), Expect = 3e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = +2 Query: 425 KQERFLSARYVVLTSELEAIMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 ++ R L+A + E M SHKSFMIKKKL KKMRQNRPIPNWIR+RTD + K Sbjct: 4 EKTRVLNAAVFRRIATGEFKMPSHKSFMIKKKLGKKMRQNRPIPNWIRLRTDNRIRYNAK 63 >ref|XP_002884307.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] gi|727581460|ref|XP_010463616.1| PREDICTED: 60S ribosomal protein L39-2 [Camelina sativa] gi|727629057|ref|XP_010485457.1| PREDICTED: 60S ribosomal protein L39-2 [Camelina sativa] gi|727629067|ref|XP_010485462.1| PREDICTED: 60S ribosomal protein L39-2 [Camelina sativa] gi|297330147|gb|EFH60566.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] Length = 51 Score = 65.5 bits (158), Expect = 4e-08 Identities = 30/40 (75%), Positives = 32/40 (80%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKL KKMRQNRPIPNWIR+RTD + K Sbjct: 1 MPSHKSFMIKKKLGKKMRQNRPIPNWIRLRTDNRIRYNAK 40 >ref|XP_010656573.1| PREDICTED: 60S ribosomal protein L39-3-like [Vitis vinifera] Length = 68 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 18 MPSHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 57 >ref|XP_010665831.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|731352802|ref|XP_010687729.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|731363282|ref|XP_010693350.1| PREDICTED: 60S ribosomal protein L39-3 [Beta vulgaris subsp. vulgaris] gi|870846632|gb|KMS99155.1| hypothetical protein BVRB_2g047340 [Beta vulgaris subsp. vulgaris] gi|870851521|gb|KMT03568.1| hypothetical protein BVRB_8g192440 [Beta vulgaris subsp. vulgaris] gi|870868146|gb|KMT19015.1| hypothetical protein BVRB_2g031110 [Beta vulgaris subsp. vulgaris] gi|902223850|gb|KNA19623.1| hypothetical protein SOVF_060190 [Spinacia oleracea] Length = 51 Score = 64.7 bits (156), Expect = 7e-08 Identities = 31/40 (77%), Positives = 32/40 (80%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKLAKKMRQNRPIP WIRMRTD + K Sbjct: 1 MPSHKSFMIKKKLAKKMRQNRPIPYWIRMRTDNTIRYNAK 40 >emb|CDY62505.1| BnaC04g56360D [Brassica napus] Length = 78 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKLAKKMRQNRPIP+WIR+RTD + K Sbjct: 28 MPSHKSFMIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAK 67 >gb|KDP38638.1| hypothetical protein JCGZ_03991 [Jatropha curcas] Length = 134 Score = 64.7 bits (156), Expect = 7e-08 Identities = 29/41 (70%), Positives = 34/41 (82%) Frame = +2 Query: 482 IMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 ++ SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 83 VLPSHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 123 >emb|CBI25619.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 22 MPSHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 61 >emb|CBI25617.3| unnamed protein product [Vitis vinifera] Length = 70 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 20 MPSHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 59 >ref|XP_006450329.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] gi|568840009|ref|XP_006473965.1| PREDICTED: 60S ribosomal protein L39-3-like [Citrus sinensis] gi|568859839|ref|XP_006483440.1| PREDICTED: 60S ribosomal protein L39-3-like [Citrus sinensis] gi|731407650|ref|XP_010656571.1| PREDICTED: 60S ribosomal protein L39-3 [Vitis vinifera] gi|769810505|ref|XP_011623846.1| PREDICTED: 60S ribosomal protein L39-3 [Amborella trichopoda] gi|802592201|ref|XP_012071455.1| PREDICTED: 60S ribosomal protein L39-3 [Jatropha curcas] gi|802715972|ref|XP_012084839.1| PREDICTED: 60S ribosomal protein L39-3 [Jatropha curcas] gi|209967447|gb|ACJ02352.1| 60S ribosomal protein L39 [Vernicia fordii] gi|257219568|gb|ACV50437.1| 60S ribosomal protein L39 [Jatropha curcas] gi|557553555|gb|ESR63569.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] gi|641827615|gb|KDO46794.1| hypothetical protein CISIN_1g035394mg [Citrus sinensis] gi|819320164|gb|AKG50109.1| RPL39 [Betula luminifera] Length = 51 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 1 MPSHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 40 >gb|EYU20493.1| hypothetical protein MIMGU_mgv1a017298mg [Erythranthe guttata] Length = 83 Score = 64.7 bits (156), Expect = 7e-08 Identities = 31/43 (72%), Positives = 33/43 (76%) Frame = +2 Query: 476 EAIMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 E+ M SHKSFMIKKKLAKK RQNRPIP WIRMRTD + K Sbjct: 30 ESTMPSHKSFMIKKKLAKKQRQNRPIPYWIRMRTDNTIRYNAK 72 >ref|XP_013587193.1| PREDICTED: 60S ribosomal protein L39-1-like [Brassica oleracea var. oleracea] gi|556502868|emb|CDJ26230.1| hypothetical protein [Brassica oleracea] Length = 51 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKLAKKMRQNRPIP+WIR+RTD + K Sbjct: 1 MPSHKSFMIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAK 40 >ref|XP_002869300.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] gi|297821901|ref|XP_002878833.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] gi|685257523|ref|XP_009126494.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica rapa] gi|685299776|ref|XP_009140630.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica rapa] gi|685345523|ref|XP_009108896.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica rapa] gi|685366001|ref|XP_009117075.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica rapa] gi|922445668|ref|XP_013626886.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica oleracea var. oleracea] gi|922469002|ref|XP_013634411.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica oleracea var. oleracea] gi|922550217|ref|XP_013603092.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica oleracea var. oleracea] gi|923505247|ref|XP_013667693.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923619896|ref|XP_013747051.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923619916|ref|XP_013747057.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923702481|ref|XP_013660037.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923778618|ref|XP_013681436.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923779246|ref|XP_013681556.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|923794030|ref|XP_013685194.1| PREDICTED: 60S ribosomal protein L39-1 [Brassica napus] gi|297315136|gb|EFH45559.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] gi|297324672|gb|EFH55092.1| 60S ribosomal protein L39 [Arabidopsis lyrata subsp. lyrata] Length = 51 Score = 64.7 bits (156), Expect = 7e-08 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHKSFMIKKKLAKKMRQNRPIP+WIR+RTD + K Sbjct: 1 MPSHKSFMIKKKLAKKMRQNRPIPHWIRLRTDNTIRYNAK 40 >ref|XP_010457149.1| PREDICTED: 60S ribosomal protein L39-2-like [Camelina sativa] Length = 51 Score = 64.3 bits (155), Expect = 9e-08 Identities = 29/40 (72%), Positives = 32/40 (80%) Frame = +2 Query: 485 MLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 M SHK+FMIKKKL KKMRQNRPIPNWIR+RTD + K Sbjct: 1 MPSHKTFMIKKKLGKKMRQNRPIPNWIRLRTDNRIRYNAK 40 >ref|XP_006450330.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] gi|557553556|gb|ESR63570.1| hypothetical protein CICLE_v10010138mg [Citrus clementina] Length = 53 Score = 63.9 bits (154), Expect = 1e-07 Identities = 29/38 (76%), Positives = 32/38 (84%) Frame = +2 Query: 491 SHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 SHK+FMIKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 5 SHKTFMIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 42 >emb|CBI21094.3| unnamed protein product [Vitis vinifera] Length = 112 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +2 Query: 479 AIMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 A M SHK+F+IKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 60 AKMPSHKTFIIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 101 >ref|XP_002523523.1| ribosomal protein L39e, putative [Ricinus communis] gi|223537230|gb|EEF38862.1| ribosomal protein L39e, putative [Ricinus communis] Length = 67 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/42 (71%), Positives = 34/42 (80%) Frame = +2 Query: 479 AIMLSHKSFMIKKKLAKKMRQNRPIPNWIRMRTDQETKTERK 604 A M SHK+F+IKKKLAKKMRQNRPIP+WIRMRTD + K Sbjct: 15 AKMPSHKTFIIKKKLAKKMRQNRPIPHWIRMRTDNTIRYNAK 56