BLASTX nr result
ID: Papaver29_contig00004706
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00004706 (492 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006857552.1| PREDICTED: probable WRKY transcription facto... 66 1e-08 gb|AKE48839.1| WRKY transcription factor 12, partial [Roystonea ... 65 3e-08 gb|AKE48838.1| WRKY transcription factor 12, partial [Roystonea ... 65 3e-08 gb|AKE48837.1| WRKY transcription factor 12, partial [Reinhardti... 65 3e-08 gb|AKE48833.1| WRKY transcription factor 12, partial [Elaeis gui... 65 3e-08 gb|AKE48831.1| WRKY transcription factor 12, partial [Desmoncus ... 65 3e-08 gb|AKE48830.1| WRKY transcription factor 12, partial [Desmoncus ... 65 3e-08 gb|AKE48829.1| WRKY transcription factor 12, partial [Barcella o... 65 3e-08 gb|AKE48827.1| WRKY transcription factor 12, partial [Bactris pl... 65 3e-08 gb|AKE48826.1| WRKY transcription factor 12, partial [Bactris mi... 65 3e-08 gb|AKE48825.1| WRKY transcription factor 12, partial [Bactris me... 65 3e-08 gb|AKE48822.1| WRKY transcription factor 12, partial [Bactris ga... 65 3e-08 gb|AKE48820.1| WRKY transcription factor 12, partial [Bactris co... 65 3e-08 gb|AKE48819.1| WRKY transcription factor 12, partial [Bactris cf... 65 3e-08 gb|AKE48818.1| WRKY transcription factor 12, partial [Bactris br... 65 3e-08 gb|AKE48817.1| WRKY transcription factor 12, partial [Astrocaryu... 65 3e-08 gb|AKE48814.1| WRKY transcription factor 12, partial [Astrocaryu... 65 3e-08 gb|AKE48813.1| WRKY transcription factor 12, partial [Astrocaryu... 65 3e-08 gb|AKE48812.1| WRKY transcription factor 12, partial [Astrocaryu... 65 3e-08 gb|AKE48811.1| WRKY transcription factor 12, partial [Astrocaryu... 65 3e-08 >ref|XP_006857552.1| PREDICTED: probable WRKY transcription factor 2 [Amborella trichopoda] gi|548861648|gb|ERN19019.1| hypothetical protein AMTR_s00061p00050690 [Amborella trichopoda] Length = 737 Score = 65.9 bits (159), Expect = 1e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 DVSA R++REPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 511 DVSAASRSIREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 551 >gb|AKE48839.1| WRKY transcription factor 12, partial [Roystonea oleracea] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 102 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 142 >gb|AKE48838.1| WRKY transcription factor 12, partial [Roystonea borinquena] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 102 ELSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 142 >gb|AKE48837.1| WRKY transcription factor 12, partial [Reinhardtia latisecta] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 102 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 142 >gb|AKE48833.1| WRKY transcription factor 12, partial [Elaeis guineensis] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 102 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 142 >gb|AKE48831.1| WRKY transcription factor 12, partial [Desmoncus polyacanthos] gi|815859568|gb|AKE48832.1| WRKY transcription factor 12, partial [Desmoncus prunifer] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48830.1| WRKY transcription factor 12, partial [Desmoncus orthacanthos] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48829.1| WRKY transcription factor 12, partial [Barcella odora] Length = 146 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 102 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 142 >gb|AKE48827.1| WRKY transcription factor 12, partial [Bactris plumeriana] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48826.1| WRKY transcription factor 12, partial [Bactris militaris] Length = 161 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 117 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 157 >gb|AKE48825.1| WRKY transcription factor 12, partial [Bactris mexicana] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48822.1| WRKY transcription factor 12, partial [Bactris gasipaes] gi|815859550|gb|AKE48823.1| WRKY transcription factor 12, partial [Bactris gasipaes] Length = 162 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 118 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 158 >gb|AKE48820.1| WRKY transcription factor 12, partial [Bactris coloniata] gi|815859546|gb|AKE48821.1| WRKY transcription factor 12, partial [Bactris concinna] gi|815859552|gb|AKE48824.1| WRKY transcription factor 12, partial [Bactris major] gi|815859560|gb|AKE48828.1| WRKY transcription factor 12, partial [Bactris sp. BRG NY Tiwari et al. 2223] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48819.1| WRKY transcription factor 12, partial [Bactris cf. maraja FTBG Acc. 84101H] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48818.1| WRKY transcription factor 12, partial [Bactris brongniartii] Length = 161 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 117 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 157 >gb|AKE48817.1| WRKY transcription factor 12, partial [Astrocaryum standleyanum] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48814.1| WRKY transcription factor 12, partial [Astrocaryum sp. 1 AWM-2015] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48813.1| WRKY transcription factor 12, partial [Astrocaryum murumuru] Length = 168 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 121 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 161 >gb|AKE48812.1| WRKY transcription factor 12, partial [Astrocaryum murumuru] gi|815859534|gb|AKE48815.1| WRKY transcription factor 12, partial [Astrocaryum sp. 2 AWM-2015] gi|815859536|gb|AKE48816.1| WRKY transcription factor 12, partial [Astrocaryum standleyanum] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162 >gb|AKE48811.1| WRKY transcription factor 12, partial [Astrocaryum mexicanum] Length = 166 Score = 64.7 bits (156), Expect = 3e-08 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = -1 Query: 492 DVSAMGRAVREPRYVVEKPSEVDVVDDGYRWHKYGRKMVKG 370 ++SA RAVREPR VV+ SEVD++DDGYRW KYG+K+VKG Sbjct: 122 EMSAASRAVREPRVVVQTTSEVDILDDGYRWRKYGQKVVKG 162