BLASTX nr result
ID: Papaver29_contig00004569
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00004569 (500 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008236963.1| PREDICTED: purple acid phosphatase 2-like is... 57 4e-06 ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [S... 56 9e-06 >ref|XP_008236963.1| PREDICTED: purple acid phosphatase 2-like isoform X1 [Prunus mume] Length = 477 Score = 57.4 bits (137), Expect = 4e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -1 Query: 137 SLFVTLFLILNVAVICNGGITSKFVRKVEKTIDMP 33 S FV L L+LN+AV+CNGGITS FVRK EKT+DMP Sbjct: 19 SSFVVLGLVLNLAVVCNGGITSPFVRKAEKTVDMP 53 >ref|XP_006362022.1| PREDICTED: purple acid phosphatase 2-like [Solanum tuberosum] Length = 465 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/41 (65%), Positives = 34/41 (82%), Gaps = 2/41 (4%) Frame = -1 Query: 149 MGLFS--LFVTLFLILNVAVICNGGITSKFVRKVEKTIDMP 33 MG+F +FV L LI+N +V+C+GG+TS FVRKVEKTIDMP Sbjct: 1 MGVFGYCIFVVLSLIVNESVLCHGGVTSSFVRKVEKTIDMP 41