BLASTX nr result
ID: Papaver29_contig00002187
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00002187 (545 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AKH61489.1| N-methyltransferase [Expression vector pWCD2353] 65 1e-08 sp|Q7XB08.1|CNMT_PAPSO RecName: Full=(S)-coclaurine N-methyltran... 65 1e-08 >gb|AKH61489.1| N-methyltransferase [Expression vector pWCD2353] Length = 353 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 103 EEWLKNMDKNIVEFKEIMRSITKTEEEANRLLNF 2 EEWLKNMDKNIVEFKEIMRSITKTE+EA +LLNF Sbjct: 288 EEWLKNMDKNIVEFKEIMRSITKTEKEAIKLLNF 321 >sp|Q7XB08.1|CNMT_PAPSO RecName: Full=(S)-coclaurine N-methyltransferase; Short=PsCNMT gi|33413898|gb|AAP45316.1| S-adenosyl-L-methionine:coclaurine N-methyltransferase [Papaver somniferum] gi|571330880|gb|AHF27396.1| S-adenosyl-L-methionine:coclaurine N-methyltransferase [synthetic construct] Length = 351 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 103 EEWLKNMDKNIVEFKEIMRSITKTEEEANRLLNF 2 EEWLKNMDKNIVEFKEIMRSITKTE+EA +LLNF Sbjct: 288 EEWLKNMDKNIVEFKEIMRSITKTEKEAIKLLNF 321