BLASTX nr result
ID: Papaver29_contig00002179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00002179 (530 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279619.1| PREDICTED: uncharacterized protein LOC100251... 60 8e-07 >ref|XP_002279619.1| PREDICTED: uncharacterized protein LOC100251255 [Vitis vinifera] Length = 708 Score = 59.7 bits (143), Expect = 8e-07 Identities = 43/110 (39%), Positives = 59/110 (53%), Gaps = 4/110 (3%) Frame = -1 Query: 320 LENQLMENLRLHGDSSCNLSGIDDLPLLSTSTINELPTRQT--DNIPTESGTLAPLSSVS 147 L N E + G+S + S +D+LP+ S T++ + T D +P GT S Sbjct: 366 LRNAAREKFKRRGES--HFSAVDNLPIASCITMDAPSSNSTEKDKLPEVVGTYPFSESDF 423 Query: 146 LESLG--AFTPLNASSQNLPSFQVPTPGSTLFSSYNNCWYPPSAPTLQYT 3 LESLG A PL + PS Q+P+ GS+LF+ Y CW PP A +LQYT Sbjct: 424 LESLGKSAAAPLIS-----PSSQIPSIGSSLFAPYY-CWCPPRASSLQYT 467