BLASTX nr result
ID: Papaver29_contig00001152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00001152 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010278515.1| PREDICTED: post-GPI attachment to proteins f... 87 4e-15 gb|KNA22127.1| hypothetical protein SOVF_036530 [Spinacia oleracea] 87 6e-15 ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Popu... 87 6e-15 ref|XP_011014824.1| PREDICTED: post-GPI attachment to proteins f... 86 1e-14 emb|CDP05250.1| unnamed protein product [Coffea canephora] 86 1e-14 ref|XP_010644976.1| PREDICTED: post-GPI attachment to proteins f... 86 1e-14 ref|XP_009383493.1| PREDICTED: post-GPI attachment to proteins f... 86 1e-14 ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins f... 86 1e-14 ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins f... 86 1e-14 ref|XP_002513401.1| conserved hypothetical protein [Ricinus comm... 86 1e-14 ref|XP_002513400.1| conserved hypothetical protein [Ricinus comm... 86 1e-14 emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera] 86 1e-14 ref|XP_011030038.1| PREDICTED: post-GPI attachment to proteins f... 85 2e-14 ref|XP_011030037.1| PREDICTED: post-GPI attachment to proteins f... 85 2e-14 emb|CDP13593.1| unnamed protein product [Coffea canephora] 85 2e-14 ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins f... 85 2e-14 ref|XP_014514531.1| PREDICTED: post-GPI attachment to proteins f... 85 2e-14 gb|KOM54942.1| hypothetical protein LR48_Vigan10g083400 [Vigna a... 85 2e-14 ref|XP_010094756.1| hypothetical protein L484_019966 [Morus nota... 85 2e-14 ref|XP_007152345.1| hypothetical protein PHAVU_004G122200g [Phas... 85 2e-14 >ref|XP_010278515.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Nelumbo nucifera] Length = 342 Score = 87.4 bits (215), Expect = 4e-15 Identities = 38/43 (88%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TIPL+YLWWSFIKDDAEFRTS LVKKVK Sbjct: 300 PYQGFVDAHALWHAATIPLSYLWWSFIKDDAEFRTSSLVKKVK 342 >gb|KNA22127.1| hypothetical protein SOVF_036530 [Spinacia oleracea] Length = 341 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTYLWWSFIKDDA++RTS+L KKVK Sbjct: 299 PYEGFVDAHALWHATTIPLTYLWWSFIKDDAKYRTSDLTKKVK 341 >ref|XP_002318250.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa] gi|118489817|gb|ABK96708.1| unknown [Populus trichocarpa x Populus deltoides] gi|222858923|gb|EEE96470.1| hypothetical protein POPTR_0012s13850g [Populus trichocarpa] Length = 348 Score = 86.7 bits (213), Expect = 6e-15 Identities = 36/43 (83%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTYLWWSF+KDDAEFRTS L+KK + Sbjct: 306 PYQGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKKAR 348 >ref|XP_011014824.1| PREDICTED: post-GPI attachment to proteins factor 3 [Populus euphratica] Length = 341 Score = 85.9 bits (211), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY G+VDAHALWH TTIPLTY+WWSFI+DDAEFRTS L+KKVK Sbjct: 299 PYEGYVDAHALWHATTIPLTYIWWSFIRDDAEFRTSNLLKKVK 341 >emb|CDP05250.1| unnamed protein product [Coffea canephora] Length = 345 Score = 85.9 bits (211), Expect = 1e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTYLWWSF KDD+EFRTS LVKK+K Sbjct: 303 PYWGFVDAHALWHATTIPLTYLWWSFAKDDSEFRTSILVKKIK 345 >ref|XP_010644976.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X2 [Vitis vinifera] Length = 343 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTY+WWSFIKDDAEF+T+ L+KKVK Sbjct: 301 PYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK 343 >ref|XP_009383493.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa acuminata subsp. malaccensis] gi|695072723|ref|XP_009383494.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Musa acuminata subsp. malaccensis] Length = 343 Score = 85.5 bits (210), Expect = 1e-14 Identities = 37/43 (86%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 P+ G+VDAHALWH TTIPLTYLWWSFIKDDA+FRTS LVKKVK Sbjct: 301 PFHGYVDAHALWHATTIPLTYLWWSFIKDDAKFRTSTLVKKVK 343 >ref|XP_002266274.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X3 [Vitis vinifera] Length = 342 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTY+WWSFIKDDAEF+T+ L+KKVK Sbjct: 300 PYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK 342 >ref|XP_002266197.1| PREDICTED: post-GPI attachment to proteins factor 3 isoform X1 [Vitis vinifera] gi|296082755|emb|CBI21760.3| unnamed protein product [Vitis vinifera] Length = 379 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTY+WWSFIKDDAEF+T+ L+KKVK Sbjct: 337 PYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK 379 >ref|XP_002513401.1| conserved hypothetical protein [Ricinus communis] gi|223547309|gb|EEF48804.1| conserved hypothetical protein [Ricinus communis] Length = 293 Score = 85.5 bits (210), Expect = 1e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GF+DAHALWH TTIPLTY+WWSFI+DDAEFRTS L+KK K Sbjct: 251 PYKGFIDAHALWHATTIPLTYIWWSFIRDDAEFRTSSLLKKAK 293 >ref|XP_002513400.1| conserved hypothetical protein [Ricinus communis] gi|223547308|gb|EEF48803.1| conserved hypothetical protein [Ricinus communis] Length = 328 Score = 85.5 bits (210), Expect = 1e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GF+DAHALWH TTIPLTY+WWSFI+DDAEFRTS L+KK K Sbjct: 286 PYKGFIDAHALWHATTIPLTYIWWSFIRDDAEFRTSSLLKKAK 328 >emb|CAN65586.1| hypothetical protein VITISV_034376 [Vitis vinifera] Length = 342 Score = 85.5 bits (210), Expect = 1e-14 Identities = 36/43 (83%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTY+WWSFIKDDAEF+T+ L+KKVK Sbjct: 300 PYEGFVDAHALWHATTIPLTYIWWSFIKDDAEFQTANLLKKVK 342 >ref|XP_011030038.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform X2 [Populus euphratica] Length = 289 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKK 315 PY GFVDAHALWH TTIPLTYLWWSF+KDDAEFRTS L+KK Sbjct: 247 PYHGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKK 287 >ref|XP_011030037.1| PREDICTED: post-GPI attachment to proteins factor 3-like isoform X1 [Populus euphratica] Length = 348 Score = 85.1 bits (209), Expect = 2e-14 Identities = 36/41 (87%), Positives = 38/41 (92%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKK 315 PY GFVDAHALWH TTIPLTYLWWSF+KDDAEFRTS L+KK Sbjct: 306 PYHGFVDAHALWHATTIPLTYLWWSFVKDDAEFRTSSLLKK 346 >emb|CDP13593.1| unnamed protein product [Coffea canephora] Length = 342 Score = 85.1 bits (209), Expect = 2e-14 Identities = 34/43 (79%), Positives = 40/43 (93%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY G+VDAHALWH TT+PLT++WWSFI+DDAEFRTS L+KKVK Sbjct: 300 PYKGYVDAHALWHATTVPLTFIWWSFIRDDAEFRTSNLIKKVK 342 >ref|XP_004968454.1| PREDICTED: post-GPI attachment to proteins factor 3-like [Setaria italica] gi|944240414|gb|KQL04722.1| hypothetical protein SETIT_002068mg [Setaria italica] Length = 346 Score = 85.1 bits (209), Expect = 2e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PYMG+ DAH+LWH +TIPLTYLWWSFIKDDAEFRTS L+KK K Sbjct: 304 PYMGYADAHSLWHASTIPLTYLWWSFIKDDAEFRTSTLIKKAK 346 >ref|XP_014514531.1| PREDICTED: post-GPI attachment to proteins factor 3 [Vigna radiata var. radiata] Length = 342 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PYMG+VDAHALWH T+IPLT+LWWSF++DDAEFRTS ++KKVK Sbjct: 300 PYMGYVDAHALWHATSIPLTFLWWSFVRDDAEFRTSAMLKKVK 342 >gb|KOM54942.1| hypothetical protein LR48_Vigan10g083400 [Vigna angularis] Length = 276 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PYMG+VDAHALWH T+IPLT+LWWSF++DDAEFRTS ++KKVK Sbjct: 234 PYMGYVDAHALWHATSIPLTFLWWSFVRDDAEFRTSAMLKKVK 276 >ref|XP_010094756.1| hypothetical protein L484_019966 [Morus notabilis] gi|587867524|gb|EXB56921.1| hypothetical protein L484_019966 [Morus notabilis] Length = 342 Score = 84.7 bits (208), Expect = 2e-14 Identities = 35/43 (81%), Positives = 39/43 (90%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PY GFVDAHALWH TTIPLTY+WWSFI+DDAEF+TS L+KK K Sbjct: 300 PYQGFVDAHALWHATTIPLTYIWWSFIRDDAEFQTSNLLKKAK 342 >ref|XP_007152345.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris] gi|561025654|gb|ESW24339.1| hypothetical protein PHAVU_004G122200g [Phaseolus vulgaris] Length = 342 Score = 84.7 bits (208), Expect = 2e-14 Identities = 34/43 (79%), Positives = 41/43 (95%) Frame = -1 Query: 437 PYMGFVDAHALWHLTTIPLTYLWWSFIKDDAEFRTSELVKKVK 309 PYMG+VDAHALWH T+IPLT+LWWSF++DDAEFRTS ++KKVK Sbjct: 300 PYMGYVDAHALWHATSIPLTFLWWSFVRDDAEFRTSAMLKKVK 342