BLASTX nr result
ID: Papaver27_contig00057140
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00057140 (423 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006464881.1| PREDICTED: putative F-box/FBD/LRR-repeat pro... 58 1e-06 ref|XP_007132594.1| hypothetical protein PHAVU_011G108100g [Phas... 58 1e-06 ref|XP_006452021.1| hypothetical protein CICLE_v10010670mg, part... 57 3e-06 ref|XP_003623802.1| F-box/LRR-repeat protein [Medicago truncatul... 56 5e-06 ref|XP_003623801.1| F-box/LRR-repeat protein [Medicago truncatul... 56 5e-06 ref|XP_003635004.1| PREDICTED: putative F-box/LRR-repeat protein... 56 6e-06 ref|XP_003607672.1| F-box family-10 [Medicago truncatula] gi|355... 55 8e-06 ref|XP_003603392.1| F-box/LRR-repeat protein [Medicago truncatul... 55 8e-06 ref|XP_003589995.1| F-box/LRR-repeat protein [Medicago truncatul... 55 8e-06 ref|XP_003589973.1| F-box/LRR-repeat protein [Medicago truncatul... 55 8e-06 emb|CAN78503.1| hypothetical protein VITISV_023071 [Vitis vinifera] 55 8e-06 >ref|XP_006464881.1| PREDICTED: putative F-box/FBD/LRR-repeat protein At4g00315-like [Citrus sinensis] Length = 448 Score = 58.2 bits (139), Expect = 1e-06 Identities = 29/54 (53%), Positives = 36/54 (66%) Frame = -3 Query: 217 RHKNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 R K DRIS LHDS+LHHI SFLP+K VV TS+++KRW+ L +L F Sbjct: 4 RQKQTKKDADRISPLHDSILHHILSFLPVKEVVQTSLVSKRWQELWKCLPYLRF 57 >ref|XP_007132594.1| hypothetical protein PHAVU_011G108100g [Phaseolus vulgaris] gi|561005594|gb|ESW04588.1| hypothetical protein PHAVU_011G108100g [Phaseolus vulgaris] Length = 510 Score = 58.2 bits (139), Expect = 1e-06 Identities = 27/45 (60%), Positives = 33/45 (73%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 DRIS+L D++LHH+ LPIKCV SIL+KRWK+L C F L F Sbjct: 24 DRISDLPDAVLHHMLFLLPIKCVAQMSILSKRWKHLWCTFPDLDF 68 >ref|XP_006452021.1| hypothetical protein CICLE_v10010670mg, partial [Citrus clementina] gi|557555247|gb|ESR65261.1| hypothetical protein CICLE_v10010670mg, partial [Citrus clementina] Length = 182 Score = 56.6 bits (135), Expect = 3e-06 Identities = 25/36 (69%), Positives = 31/36 (86%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 DRIS LHDS+LHHI SFLP+K VV TS+++KRW+ L Sbjct: 14 DRISPLHDSILHHILSFLPVKEVVQTSLVSKRWQEL 49 >ref|XP_003623802.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355498817|gb|AES80020.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 394 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -3 Query: 205 MGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFAN 50 M +DRIS+L D ++HHI S++P K V TS+L+KRW L C FL F++ Sbjct: 1 MAPSEDRISKLDDKIIHHILSYVPTKDAVTTSVLSKRWTNLWCFVPFLDFSD 52 >ref|XP_003623801.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355498816|gb|AES80019.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 431 Score = 56.2 bits (134), Expect = 5e-06 Identities = 25/52 (48%), Positives = 35/52 (67%) Frame = -3 Query: 205 MGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFAN 50 M +DRIS+L D ++HHI S++P K V TS+L+KRW L C FL F++ Sbjct: 1 MAPSEDRISKLDDKIIHHILSYVPTKDAVTTSVLSKRWTNLWCFVPFLDFSD 52 >ref|XP_003635004.1| PREDICTED: putative F-box/LRR-repeat protein At5g02930-like [Vitis vinifera] Length = 610 Score = 55.8 bits (133), Expect = 6e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -3 Query: 280 FCTSSLSGF*QSTSDLSQRDYRHKNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILA 101 + +S SG QS D + + KD ISEL DS+L I SFLP+K VVATSIL+ Sbjct: 44 YYSSHESGANQSVRGDDDEDDGDEEISSRKDGISELSDSILIRILSFLPMKYVVATSILS 103 Query: 100 KRWKYL 83 KRW++L Sbjct: 104 KRWQFL 109 >ref|XP_003607672.1| F-box family-10 [Medicago truncatula] gi|355508727|gb|AES89869.1| F-box family-10 [Medicago truncatula] Length = 388 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/42 (64%), Positives = 30/42 (71%) Frame = -3 Query: 208 NMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL 83 N+G GKD IS L D +LHHI S LP K V TSILA+RWK L Sbjct: 11 NVGDGKDFISNLPDEILHHILSLLPAKDAVGTSILARRWKSL 52 >ref|XP_003603392.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355492440|gb|AES73643.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 408 Score = 55.5 bits (132), Expect = 8e-06 Identities = 27/47 (57%), Positives = 34/47 (72%) Frame = -3 Query: 190 DRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTFAN 50 DRIS L ++L+ HI SFLP K VATS+LAKRW +L C L + F+N Sbjct: 11 DRISNLPETLICHILSFLPTKQAVATSVLAKRWIHLWCSVLAINFSN 57 >ref|XP_003589995.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355479043|gb|AES60246.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 450 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -3 Query: 196 GKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 G+DRIS L DSLL+HI SFLP+K AT++L+KRWK L L L F Sbjct: 84 GEDRISALPDSLLYHILSFLPMKDTAATTVLSKRWKPLFLSQLILNF 130 >ref|XP_003589973.1| F-box/LRR-repeat protein [Medicago truncatula] gi|355479021|gb|AES60224.1| F-box/LRR-repeat protein [Medicago truncatula] Length = 485 Score = 55.5 bits (132), Expect = 8e-06 Identities = 28/47 (59%), Positives = 34/47 (72%) Frame = -3 Query: 196 GKDRISELHDSLLHHIFSFLPIKCVVATSILAKRWKYL*CLFLFLTF 56 G+DRIS L DSLL+HI SFLP+K AT++L+KRWK L L L F Sbjct: 84 GEDRISALPDSLLYHILSFLPMKDTAATTVLSKRWKPLFLSQLILNF 130 >emb|CAN78503.1| hypothetical protein VITISV_023071 [Vitis vinifera] Length = 891 Score = 55.5 bits (132), Expect = 8e-06 Identities = 32/66 (48%), Positives = 41/66 (62%) Frame = -3 Query: 280 FCTSSLSGF*QSTSDLSQRDYRHKNMGVGKDRISELHDSLLHHIFSFLPIKCVVATSILA 101 + +S SG QS D + + KD ISEL DS+L I SFLP+K VVATSIL+ Sbjct: 44 YYSSHDSGANQSVRGDDDEDDGDEEISSRKDGISELSDSILIRILSFLPMKYVVATSILS 103 Query: 100 KRWKYL 83 KRW++L Sbjct: 104 KRWQFL 109