BLASTX nr result
ID: Papaver27_contig00056151
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00056151 (748 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACY01936.1| hypothetical protein [Beta vulgaris] 54 2e-06 >gb|ACY01936.1| hypothetical protein [Beta vulgaris] Length = 252 Score = 53.9 bits (128), Expect(2) = 2e-06 Identities = 20/56 (35%), Positives = 39/56 (69%) Frame = -3 Query: 221 QTNVPVFKGDSFNFWSTKLRIIFIAYDLRDLVESGYDEIDLEKATPDQKKKSTKRR 54 Q ++P+FKG+ ++ WS K++ +F + +L D+VE GY+E + A P+QK + +++ Sbjct: 11 QPSIPIFKGEKYHLWSVKMQTLFKSQELWDIVECGYEEPNESPAEPNQKLRENRKK 66 Score = 24.6 bits (52), Expect(2) = 2e-06 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 63 KEKVRKDAKALAVIPEGVDD 4 +E +KDAKAL I VDD Sbjct: 61 RENRKKDAKALCFIQSAVDD 80