BLASTX nr result
ID: Papaver27_contig00056150
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00056150 (521 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007043776.1| Uncharacterized protein TCM_008325 [Theobrom... 55 8e-06 >ref|XP_007043776.1| Uncharacterized protein TCM_008325 [Theobroma cacao] gi|508707711|gb|EOX99607.1| Uncharacterized protein TCM_008325 [Theobroma cacao] Length = 447 Score = 55.5 bits (132), Expect = 8e-06 Identities = 22/57 (38%), Positives = 35/57 (61%) Frame = +3 Query: 351 ELAVFILFWLCHDVFEHSPQDTIKGELVPMSVLLSRSVSFPLAPMFLGGFYRHLYLF 521 EL I+FWL V + P D I +VP+++ + + + FPLAP++LG Y+ L L+ Sbjct: 184 ELVALIIFWLAQHVLQGCPDDGISSAVVPLAIKIIKGICFPLAPLYLGSLYKRLDLY 240